Recombinant Human CD276 Protein, C-His-tagged

Cat.No. : CD276-145H
Product Overview : Recombinant Human CD276 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : B7 homolog 3 (B7-H3, CD276) is a member of the B7 family of cell surface ligands that regulate T cell activation and immune responses. B7-H3 protein contains two extracellular Ig-like V-type domains and two IgG-like C2-type domains, a transmembrane domain, and a short intracellular domain. Early research examining the biological process of B7-H3 suggested that B7-H3 is a positive regulator of T cell response. Subsequent research studies indicated that B7-H3 is a negative regulator of T cell response, and that the protein inhibits T cell proliferation. One possibility is that B7-H3 interacts with two distinct sets of receptors, resulting in seemingly opposite biological outcomes. B7-H3 is expressed by antigen presenting cells, activated T cells, and a few normal tissues, including placenta and prostate. Expression of B7-H3 is seen in several cancer types, including prostate, breast, colon, lung, and gastric cancers, and in endothelial cells from tumor associated vasculature.
Molecular Mass : ~48 kDa
AA Sequence : LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEA
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD276 CD276 molecule [ Homo sapiens (human) ]
Official Symbol CD276
Synonyms CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3;
Gene ID 80381
mRNA Refseq NM_001024736
Protein Refseq NP_001019907
MIM 605715
UniProt ID Q5ZPR3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD276 Products

Required fields are marked with *

My Review for All CD276 Products

Required fields are marked with *

0
cart-icon