Recombinant Human CD276 Protein, C-His-tagged
| Cat.No. : | CD276-145H |
| Product Overview : | Recombinant Human CD276 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | B7 homolog 3 (B7-H3, CD276) is a member of the B7 family of cell surface ligands that regulate T cell activation and immune responses. B7-H3 protein contains two extracellular Ig-like V-type domains and two IgG-like C2-type domains, a transmembrane domain, and a short intracellular domain. Early research examining the biological process of B7-H3 suggested that B7-H3 is a positive regulator of T cell response. Subsequent research studies indicated that B7-H3 is a negative regulator of T cell response, and that the protein inhibits T cell proliferation. One possibility is that B7-H3 interacts with two distinct sets of receptors, resulting in seemingly opposite biological outcomes. B7-H3 is expressed by antigen presenting cells, activated T cells, and a few normal tissues, including placenta and prostate. Expression of B7-H3 is seen in several cancer types, including prostate, breast, colon, lung, and gastric cancers, and in endothelial cells from tumor associated vasculature. |
| Molecular Mass : | ~48 kDa |
| AA Sequence : | LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEA |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | CD276 CD276 molecule [ Homo sapiens (human) ] |
| Official Symbol | CD276 |
| Synonyms | CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3; |
| Gene ID | 80381 |
| mRNA Refseq | NM_001024736 |
| Protein Refseq | NP_001019907 |
| MIM | 605715 |
| UniProt ID | Q5ZPR3 |
| ◆ Recombinant Proteins | ||
| CD276-1235CF | Recombinant Monkey CD276 Protein, Fc-tagged, FITC conjugated | +Inquiry |
| Cd276-41RAF488 | Recombinant Rat Cd276 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| Cd276-40RAF555 | Recombinant Rat Cd276 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| CD276-941M | Recombinant Mouse CD276 protein, His-tagged | +Inquiry |
| CD276-542HAF555 | Active Recombinant Human CD276 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD276-001MCL | Recombinant Mouse CD276 cell lysate | +Inquiry |
| CD276-1959HCL | Recombinant Human CD276 cell lysate | +Inquiry |
| CD276-826RCL | Recombinant Rat CD276 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD276 Products
Required fields are marked with *
My Review for All CD276 Products
Required fields are marked with *
