Recombinant Human CD28 Protein, GST-Tagged

Cat.No. : CD28-0774H
Product Overview : Human CD28 full-length ORF (AAH93698.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]
Molecular Mass : 51.5 kDa
AA Sequence : MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD28 CD28 molecule [ Homo sapiens ]
Official Symbol CD28
Synonyms CD28; CD28 molecule; CD28 antigen (Tp44); T-cell-specific surface glycoprotein CD28; T cell specific surface glycoprotein; CD28 antigen; Tp44; MGC138290;
Gene ID 940
mRNA Refseq NM_001243077
Protein Refseq NP_001230006
MIM 186760
UniProt ID P10747

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD28 Products

Required fields are marked with *

My Review for All CD28 Products

Required fields are marked with *

0
cart-icon