Recombinant Human CD28 Protein, GST-Tagged
Cat.No. : | CD28-0774H |
Product Overview : | Human CD28 full-length ORF (AAH93698.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011] |
Molecular Mass : | 51.5 kDa |
AA Sequence : | MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD28 CD28 molecule [ Homo sapiens ] |
Official Symbol | CD28 |
Synonyms | CD28; CD28 molecule; CD28 antigen (Tp44); T-cell-specific surface glycoprotein CD28; T cell specific surface glycoprotein; CD28 antigen; Tp44; MGC138290; |
Gene ID | 940 |
mRNA Refseq | NM_001243077 |
Protein Refseq | NP_001230006 |
MIM | 186760 |
UniProt ID | P10747 |
◆ Recombinant Proteins | ||
CD28-182H | Recombinant Human CD28 Protein, Fc-tagged | +Inquiry |
CD28-1593H | Recombinant Human CD28 Molecule | +Inquiry |
CD28-562H | Recombinant Human/Cynomolgus/Rhesus macaque CD28 protein, Fc-tagged (HPLC-verified) | +Inquiry |
CD28-321HAF647 | Recombinant Human CD28 Protein, Alexa Fluor 647 conjugated | +Inquiry |
CD28-1099RF | Recombinant Rat CD28 Protein, Fc-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD28-2002MCL | Recombinant Mouse CD28 cell lysate | +Inquiry |
CD28-2013HCL | Recombinant Human CD28 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD28 Products
Required fields are marked with *
My Review for All CD28 Products
Required fields are marked with *
0
Inquiry Basket