Recombinant Human CD300C Protein, GST-Tagged
| Cat.No. : | CD300C-0779H |
| Product Overview : | Human CD300C full-length ORF (AAH22279, 21 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM, Mar 2008] |
| Molecular Mass : | 48.18 kDa |
| AA Sequence : | GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLLLSMLGAVLWVNRPQRSSRSRQNWPKGENQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CD300C CD300c molecule [ Homo sapiens ] |
| Official Symbol | CD300C |
| Synonyms | CD300C; CD300c molecule; CD300c antigen; CMRF35-like molecule 6; CMRF 35A; CMRF35; CMRF35A; IGSF16; LIR; CMRF35 antigen; CD300 antigen-like family member C; immunoglobulin superfamily member 16; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35A leukocyte immunoglobulin-like receptor; CLM-6; CMRF-35; CMRF-35A; CMRF35A1; CMRF35-A1; |
| Gene ID | 10871 |
| mRNA Refseq | NM_006678 |
| Protein Refseq | NP_006669 |
| MIM | 606786 |
| UniProt ID | Q08708 |
| ◆ Recombinant Proteins | ||
| CD300C-7216H | Recombinant Human CD300C, His-tagged | +Inquiry |
| CD300C-3072M | Recombinant Mouse CD300C Protein | +Inquiry |
| CD300C-0779H | Recombinant Human CD300C Protein, GST-Tagged | +Inquiry |
| CD300C-3087M | Active Recombinant mouse CD300C Protein, mIgG2A-tagged | +Inquiry |
| CD300C-01H | Recombinant Human CD300C Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD300C-2096HCL | Recombinant Human CD300C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD300C Products
Required fields are marked with *
My Review for All CD300C Products
Required fields are marked with *



