Recombinant Human CD300C Protein, GST-Tagged
Cat.No. : | CD300C-0779H |
Product Overview : | Human CD300C full-length ORF (AAH22279, 21 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 48.18 kDa |
AA Sequence : | GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLLLSMLGAVLWVNRPQRSSRSRQNWPKGENQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD300C CD300c molecule [ Homo sapiens ] |
Official Symbol | CD300C |
Synonyms | CD300C; CD300c molecule; CD300c antigen; CMRF35-like molecule 6; CMRF 35A; CMRF35; CMRF35A; IGSF16; LIR; CMRF35 antigen; CD300 antigen-like family member C; immunoglobulin superfamily member 16; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35A leukocyte immunoglobulin-like receptor; CLM-6; CMRF-35; CMRF-35A; CMRF35A1; CMRF35-A1; |
Gene ID | 10871 |
mRNA Refseq | NM_006678 |
Protein Refseq | NP_006669 |
MIM | 606786 |
UniProt ID | Q08708 |
◆ Recombinant Proteins | ||
CD300C-148H | Recombinant Human CD300C Protein, His-tagged | +Inquiry |
CD300C-1038H | Recombinant Human CD300C Protein (Gly21-Arg183), His tagged | +Inquiry |
Cd300c-4533M | Recombinant Mouse Cd300c protein, GST-tagged | +Inquiry |
RFL5748MF | Recombinant Full Length Mouse Cmrf35-Like Molecule 6(Cd300C) Protein, His-Tagged | +Inquiry |
CD300C-1451M | Recombinant Mouse CD300C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD300C-2096HCL | Recombinant Human CD300C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD300C Products
Required fields are marked with *
My Review for All CD300C Products
Required fields are marked with *
0
Inquiry Basket