Recombinant Human CD300C Protein, GST-Tagged

Cat.No. : CD300C-0779H
Product Overview : Human CD300C full-length ORF (AAH22279, 21 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM, Mar 2008]
Molecular Mass : 48.18 kDa
AA Sequence : GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLLLSMLGAVLWVNRPQRSSRSRQNWPKGENQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD300C CD300c molecule [ Homo sapiens ]
Official Symbol CD300C
Synonyms CD300C; CD300c molecule; CD300c antigen; CMRF35-like molecule 6; CMRF 35A; CMRF35; CMRF35A; IGSF16; LIR; CMRF35 antigen; CD300 antigen-like family member C; immunoglobulin superfamily member 16; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35A leukocyte immunoglobulin-like receptor; CLM-6; CMRF-35; CMRF-35A; CMRF35A1; CMRF35-A1;
Gene ID 10871
mRNA Refseq NM_006678
Protein Refseq NP_006669
MIM 606786
UniProt ID Q08708

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD300C Products

Required fields are marked with *

My Review for All CD300C Products

Required fields are marked with *

0
cart-icon