Recombinant Human CD300LD protein, His-tagged

• Cat.No.: CD300LD-4670H
• Product Overview: Recombinant Human CD300LD protein(Q6UXZ3)(19-165 aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 19-165 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 18.2 kDa
• AASequence: AKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: CD300LD CD300 molecule-like family member d [ Homo sapiens ]
• Official Symbol: CD300LD
• Synonyms: CLM-4; CD300D; CMRF35A4; CMRF35-A4
• Gene ID: 100131439
• mRNA Refseq: NM_001115152.1
• Protein Refseq: NP_001108624.1
• UniProt ID: Q6UXZ3