Recombinant Human CD300LD protein, His-tagged
Cat.No. : | CD300LD-4670H |
Product Overview : | Recombinant Human CD300LD protein(Q6UXZ3)(19-165 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-165 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 18.2 kDa |
AASequence : | AKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | CD300LD CD300 molecule-like family member d [ Homo sapiens ] |
Official Symbol | CD300LD |
Synonyms | CLM-4; CD300D; CMRF35A4; CMRF35-A4 |
Gene ID | 100131439 |
mRNA Refseq | NM_001115152.1 |
Protein Refseq | NP_001108624.1 |
UniProt ID | Q6UXZ3 |
◆ Recombinant Proteins | ||
CD300LD-3075M | Recombinant Mouse CD300LD Protein | +Inquiry |
CD300LD-1453M | Recombinant Mouse CD300LD Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd300ld-4672M | Recombinant Mouse Cd300ld protein, His-tagged | +Inquiry |
CD300LD-4670H | Recombinant Human CD300LD protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD300LD Products
Required fields are marked with *
My Review for All CD300LD Products
Required fields are marked with *