Recombinant Human CD300LD protein, His-tagged

Cat.No. : CD300LD-4670H
Product Overview : Recombinant Human CD300LD protein(Q6UXZ3)(19-165 aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 19-165 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 18.2 kDa
AASequence : AKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name CD300LD CD300 molecule-like family member d [ Homo sapiens ]
Official Symbol CD300LD
Synonyms CLM-4; CD300D; CMRF35A4; CMRF35-A4
Gene ID 100131439
mRNA Refseq NM_001115152.1
Protein Refseq NP_001108624.1
UniProt ID Q6UXZ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD300LD Products

Required fields are marked with *

My Review for All CD300LD Products

Required fields are marked with *

0
cart-icon
0
compare icon