Recombinant Human CD320 Protein, HIS-tagged

Cat.No. : CD320-044H
Product Overview : Recombinant Human CD320 fused with His tag at C-termina was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Form : Lyophilized from a 0.2 µM filtered solution of 10mM Tris-Citrate,150mM NaCl, pH 7.4
Molecular Mass : 21.1kD
AA Sequence : SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name CD320 CD320 molecule [ Homo sapiens (human) ]
Official Symbol CD320
Synonyms 8D6; 8D6A; TCBLR; CD320;
Gene ID 51293
mRNA Refseq NM_001165895.1
Protein Refseq NP_057663
MIM 606475
UniProt ID F5H6D3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD320 Products

Required fields are marked with *

My Review for All CD320 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon