Recombinant Human CD34 Protein, C-His-tagged
Cat.No. : | CD34-192H |
Product Overview : | Recombinant Human CD34 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD34 is a type I transmembrane glycophosphoprotein expressed by hematopoietic stem/progenitor cells, vascular endothelium and some fibroblasts . CD34 expression has been the hallmark used to identify hematopoietic stem cells for many years. CD34+ hematopoietic stem cells expand and differentiate into all the lymphohematopoietic lineages upon cytokine or growth factor stimulation and lose CD34 expression upon differentiation. However, recent studies performed in various laboratories conflict with that convention. The extracellular domain of CD34 is homologous to CD43, a protein involved in cell-cell adhesion, and CD34 has been shown to function as a negative regulator of cell adhesion. CD34 associates with CrkL but not CrkII, is a substrate for PKC, and activation of PKC is coupled with surface expression of CD34. |
Molecular Mass : | ~29 kDa |
AA Sequence : | SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD34 CD34 molecule [ Homo sapiens (human) ] |
Official Symbol | CD34 |
Synonyms | CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34; |
Gene ID | 947 |
mRNA Refseq | NM_001025109 |
Protein Refseq | NP_001020280 |
MIM | 142230 |
UniProt ID | P28906 |
◆ Recombinant Proteins | ||
CD34-267H | Recombinant Human CD34 protein, Fc-tagged | +Inquiry |
CD34-0792H | Recombinant Human CD34 Protein, GST-Tagged | +Inquiry |
CD34-5345H | Recombinant Human CD34 Protein (Met1-Thr290), C-His tagged | +Inquiry |
CD34-3099H | Recombinant Human CD34 Protein, MYC/DDK-tagged | +Inquiry |
CD34-152H | Recombinant Human CD34 Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD34-1408RCL | Recombinant Rat CD34 cell lysate | +Inquiry |
CD34-3047HCL | Recombinant Human CD34 cell lysate | +Inquiry |
CD34-2232MCL | Recombinant Mouse CD34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD34 Products
Required fields are marked with *
My Review for All CD34 Products
Required fields are marked with *
0
Inquiry Basket