Recombinant Human CD34 Protein, GST-Tagged
| Cat.No. : | CD34-0792H |
| Product Overview : | Human CD34 full-length ORF (NP_001764.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 61.71 kDa |
| AA Sequence : | MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLELEP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CD34 CD34 molecule [ Homo sapiens ] |
| Official Symbol | CD34 |
| Synonyms | CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34; |
| Gene ID | 947 |
| mRNA Refseq | NM_001025109 |
| Protein Refseq | NP_001020280 |
| MIM | 142230 |
| UniProt ID | P28906 |
| ◆ Recombinant Proteins | ||
| CD34-3099H | Recombinant Human CD34 Protein, MYC/DDK-tagged | +Inquiry |
| CD34-651H | Recombinant Human CD34 protein, hFc-tagged | +Inquiry |
| Cd34-833M | Recombinant Mouse Cd34 Protein, MYC/DDK-tagged | +Inquiry |
| CD34-7520H | Recombinant Human CD34, His-tagged | +Inquiry |
| CD34-3650H | Recombinant Human CD34 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD34-3047HCL | Recombinant Human CD34 cell lysate | +Inquiry |
| CD34-2232MCL | Recombinant Mouse CD34 cell lysate | +Inquiry |
| CD34-1408RCL | Recombinant Rat CD34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD34 Products
Required fields are marked with *
My Review for All CD34 Products
Required fields are marked with *
