Recombinant Human CD3E Protein, His-tagged

Cat.No. : CD3E-141H
Product Overview : Recombinant human CD3E protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 207
Description : The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Form : Lyophilized
Molecular Mass : 13.2 kDa
AA Sequence : MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens (human) ]
Official Symbol CD3E
Synonyms CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell antigen receptor complex, epsilon subunit of T3; T3E; TCRE; FLJ18683;
Gene ID 916
mRNA Refseq NM_000733
Protein Refseq NP_000724
MIM 186830
UniProt ID P07766

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD3E Products

Required fields are marked with *

My Review for All CD3E Products

Required fields are marked with *

0
cart-icon
0
compare icon