Recombinant Human CD47 Protein, Fc-tagged

Cat.No. : CD47-837H
Product Overview : Recombinant Human CD47, transcript variant 2, fused with Fc tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Description : This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 40.8kD
AA Sequence : QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name CD47 CD47 molecule [ Homo sapiens ]
Official Symbol CD47
Synonyms CD47; CD47 molecule; CD47 antigen (Rh related antigen, integrin associated signal transducer) , MER6; leukocyte surface antigen CD47; antigen identified by monoclonal 1D8; antigenic surface determinant protein OA3; CD47 glycoprotein; IAP; integrin associated protein; OA3; Rh related antigen; Rh-related antigen; integrin-associated protein; integrin-associated signal transducer; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); MER6;
Gene ID 961
mRNA Refseq NM_001777
Protein Refseq NP_001768
MIM 601028
UniProt ID Q08722

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD47 Products

Required fields are marked with *

My Review for All CD47 Products

Required fields are marked with *

0
cart-icon