Recombinant Human CD48 Protein
Cat.No. : | CD48-646H |
Product Overview : | Recombinant human CD48 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 243 |
Description : | This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 23.2 kDa |
AA Sequence : | MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD48 CD48 molecule [ Homo sapiens (human) ] |
Official Symbol | CD48 |
Synonyms | CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein) , CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2; TCT.1; BCM1 surface antigen; leukocyte antigen MEM-102; B-lymphocyte activation marker BLAST-1; CD48 antigen (B-cell membrane protein); BCM1; BLAST1; MEM-102; |
Gene ID | 962 |
mRNA Refseq | NM_001256030 |
Protein Refseq | NP_001242959 |
MIM | 109530 |
UniProt ID | P09326 |
◆ Recombinant Proteins | ||
Cd48-8762R | Recombinant Rat Cd48 protein(Met1-Arg216), hFc-tagged | +Inquiry |
CD48-867MAF647 | Active Recombinant Mouse CD48 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Cd48-486M | Recombinant Mouse Cd48 protein, hFc-tagged | +Inquiry |
CD48-10960H | Recombinant Human CD48 Protein, GST-tagged | +Inquiry |
CD48-1416H | Recombinant Human CD48 Protein (Gln27-Ser220), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD48-2468MCL | Recombinant Mouse CD48 cell lysate | +Inquiry |
CD48-1258RCL | Recombinant Rat CD48 cell lysate | +Inquiry |
CD48-3044HCL | Recombinant Human CD48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD48 Products
Required fields are marked with *
My Review for All CD48 Products
Required fields are marked with *
0
Inquiry Basket