Recombinant Human CD48 Protein, Fc/His-tagged
| Cat.No. : | CD48-838H |
| Product Overview : | Recombinant Human CD48 fused with Fc/His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&His |
| Description : | Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation |
| Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
| Molecular Mass : | 53.1kD |
| AA Sequence : | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | CD48 CD48 molecule [ Homo sapiens ] |
| Official Symbol | CD48 |
| Synonyms | CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein) , CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2; TCT.1; BCM1 surface antigen; leukocyte antigen MEM-102; B-lymphocyte activation marker BLAST-1; CD48 antigen (B-cell membrane protein); BCM1; BLAST1; MEM-102; |
| Gene ID | 962 |
| mRNA Refseq | NM_001256030 |
| Protein Refseq | NP_001242959 |
| MIM | 109530 |
| UniProt ID | P09326 |
| ◆ Recombinant Proteins | ||
| CD48-5357H | Recombinant Human CD48 Protein (Met1-Ser220), C-Fc tagged | +Inquiry |
| CD48-3255H | Active Recombinant Human CD48 protein(Met1-Ser220), His&Avi-tagged, Biotinylated | +Inquiry |
| CD48-63HF | Recombinant Full Length Human CD48 Protein | +Inquiry |
| CD48-252HF | Recombinant Human CD48 Protein, Fc-tagged, FITC conjugated | +Inquiry |
| CD48-35H | Recombinant Human CD48 Protein (ECD), His-tagged(C-ter) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD48-3044HCL | Recombinant Human CD48 cell lysate | +Inquiry |
| CD48-2468MCL | Recombinant Mouse CD48 cell lysate | +Inquiry |
| CD48-1258RCL | Recombinant Rat CD48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD48 Products
Required fields are marked with *
My Review for All CD48 Products
Required fields are marked with *




