"CD6" Related Products

Expand
Expand
Expand

Recombinant Human CD6 protein, His/T7-tagged

Cat.No.: CD6-312H
Product Overview: Recombinant Human CD6(18-402 aa) fused with His/T7 tag at N-terminal was expressed in E. coli.
Description: This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion molecule. The gene product is important for continuation of T cell activation. This gene may be associated with susceptibility to multiple sclerosis (PMID: 19525953, 21849685). Multiple transcript variants encoding different isoforms have been found for this gene.
Source: E. coli
Species: Human
Tag: His/T7
Form: Liquid
Molecular Mass: 44 kDa
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFHPSPAPPDQLNTSSAESELWE PGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGC GGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCE VVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDD TWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLW DCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNT VCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLS NCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVT VKIENKESRELMLL
Purity: >90% by SDS-PAGE.
Applications: SDS-PAGE
Concentration: 50 µg at 0.5 mg/ml
Shipping: Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
Gene Name: CD6 CD6 molecule [ Homo sapiens ]
Official Symbol: CD6
Synonyms: CD6; CD6 molecule; CD6 antigen; T-cell differentiation antigen CD6; Tp120; T12; TP120; FLJ44171;
Gene ID: 923
mRNA Refseq: NM_001254750
Protein Refseq: NP_001241679
MIM: 186720
UniProt ID: P30203
Chromosome Location: 11q12.2
Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem;
Function: scavenger receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.