Recombinant Human CD6 protein, His/T7-tagged
| Cat.No. : | CD6-312H |
| Product Overview : | Recombinant Human CD6(18-402 aa) fused with His/T7 tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 18-402 a.a. |
| Description : | This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion molecule. The gene product is important for continuation of T cell activation. This gene may be associated with susceptibility to multiple sclerosis (PMID: 19525953, 21849685). Multiple transcript variants encoding different isoforms have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 44 kDa |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFHPSPAPPDQLNTSSAESELWE PGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGC GGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCE VVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDD TWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLW DCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNT VCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLS NCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVT VKIENKESRELMLL |
| Purity : | >90% by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Concentration : | 50 µg at 0.5 mg/ml |
| Shipping : | Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. |
| Gene Name | CD6 CD6 molecule [ Homo sapiens ] |
| Official Symbol | CD6 |
| Synonyms | CD6; CD6 molecule; CD6 antigen; T-cell differentiation antigen CD6; Tp120; T12; TP120; FLJ44171; |
| Gene ID | 923 |
| mRNA Refseq | NM_001254750 |
| Protein Refseq | NP_001241679 |
| MIM | 186720 |
| UniProt ID | P30203 |
| Chromosome Location | 11q12.2 |
| Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
| Function | scavenger receptor activity; |
| ◆ Recombinant Proteins | ||
| CD6-1495H | Recombinant Human CD6 Protein (His18-Cys350), N-His tagged | +Inquiry |
| CD6-6883HF | Recombinant Full Length Human CD6 Protein | +Inquiry |
| CD6-5299H | Recombinant Human CD6 Protein (Met1-Glu398), C-Fc tagged | +Inquiry |
| Cd6-5665M | Recombinant Mouse Cd6 protein, His & T7-tagged | +Inquiry |
| CD6-4377H | Recombinant Human CD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD6-958RCL | Recombinant Rat CD6 cell lysate | +Inquiry |
| CD6-1807MCL | Recombinant Mouse CD6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD6 Products
Required fields are marked with *
My Review for All CD6 Products
Required fields are marked with *



