Recombinant Full Length Human CD6 Protein

Cat.No. : CD6-6883HF
Product Overview : Recombinant full-length Human CD6 was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 668 amino acids
Description : This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion mol
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 68.9 kDa
AA Sequence : MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWD SRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRR ARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHR DQVNCSGAEAYLWDCPGLPGQHYCGHKEDA
Applications : Antibody Production.Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet.
Notes : Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CD6 CD6 molecule [ Homo sapiens ]
Official Symbol CD6
Synonyms CD6; CD6 molecule; CD6 antigen; T-cell differentiation antigen CD6; Tp120; T12; TP120; FLJ44171;
Gene ID 923
mRNA Refseq NM_001254750
Protein Refseq NP_001241679
MIM 186720
UniProt ID P30203

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD6 Products

Required fields are marked with *

My Review for All CD6 Products

Required fields are marked with *

0
cart-icon
0
compare icon