Recombinant Human CD63 Protein
Cat.No. : | CD63-0840H |
Product Overview : | Human CD63 full-length ORF (NP_001771.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012] |
Form : | Liquid |
Molecular Mass : | 25.6 kDa |
AA Sequence : | MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CD63 CD63 molecule [ Homo sapiens ] |
Official Symbol | CD63 |
Synonyms | CD63; CD63 molecule; CD63 antigen (melanoma 1 antigen), MLA1; CD63 antigen; ME491; TSPAN30; tspan-30; granulophysin; tetraspanin-30; melanoma-associated antigen MLA1; CD63 antigen (melanoma 1 antigen); melanoma-associated antigen ME491; ocular melanoma-associated antigen; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; MLA1; LAMP-3; OMA81H; |
Gene ID | 967 |
mRNA Refseq | NM_001257389 |
Protein Refseq | NP_001244318 |
MIM | 155740 |
UniProt ID | P08962 |
◆ Recombinant Proteins | ||
RFL10469MF | Recombinant Full Length Mouse Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
CD63-919R | Recombinant Rat CD63 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD63-151H | Recombinant Human CD63 Protein, DYKDDDDK-tagged | +Inquiry |
CD63-1382H | Recombinant Human CD63 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cd63-2669M | Recombinant Mouse Cd63 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry |
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD63 Products
Required fields are marked with *
My Review for All CD63 Products
Required fields are marked with *