Recombinant Human CD69 protein, His-tagged

Cat.No. : CD69-2225H
Product Overview : Recombinant Human CD69 protein(Q07108)(62-199aa), fused with C-terminal His tag, was expressed in HEK293.
Availability June 11, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Case Study
  • Application
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 62-199aa
Tag : C-His
Form : Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody, the EC50 is 23.17-26.04 ng/mL.
Molecular Mass : 18.7 kDa
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Gene Name CD69 CD69 molecule [ Homo sapiens ]
Official Symbol CD69
Synonyms CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; leukocyte surface antigen Leu-23; early T-cell activation antigen p60; early lymphocyte activation antigen; activation inducer molecule (AIM/CD69); C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell activation antigen); AIM; EA1; MLR-3; GP32/28; BL-AC/P26;
Gene ID 969
mRNA Refseq NM_001781
Protein Refseq NP_001772
MIM 107273
UniProt ID Q07108

Case 1: Koizume S, et al. Cancer Sci. 2023

Cancer tissues often lack oxygen and nutrients due to poor blood supply. We've found that in ovarian clear cell carcinoma (CCC) cells, ICAM1 is highly active during fatty acid and oxygen starvation, helping the cells resist death. Similarly, CD69, a protein known for activating immune cells, is also produced in CCC cells. Our research shows that CD69 boosts CCC cells' ability to stick to fibronectin, enhancing survival by promoting epithelial-mesenchymal transition. Tests on tumor samples showed CD69 is mostly found in CCC tumors compared to other ovarian cancer types. This indicates that CD69 may aid CCC progression through its interaction with fibronectin.

Fig1. Western blot analysis of CD69 expression.

Fig2. Western blot analysis of CD69 expression in shRNA transfected OVSAYO cells.

Case 2: Ishikawa C, et al. Biochim Biophys Acta. 2013

HTLV-1 infection is linked to adult T-cell leukemia (ATL) and other inflammatory diseases. CD69, a marker for lymphocyte activation, is influenced by HTLV-1. Our study showed that CD69 expression increases in most HTLV-1-transformed T-cell lines and ATL patient cells due to the viral protein Tax, unlike in MT-2 cells and normal blood cells where it's absent. Tax boosts CD69 through specific signaling pathways. In MT-2 cells, CD69 isn't expressed due to an epigenetic change. Overall, CD69 is regulated by Tax, potentially impacting cell activation and HTLV-1-related diseases.

Fig1. Flow cytometric analysis of Tax-mediated cell surface expression of CD69.

Fig2. HTLV-1 infection is associated with binding of NF-κB to the NF-κB sites in CD69 promoter.

Recombinant CD69 protein is widely used in both research and industrial settings. In the lab, it's an important marker for identifying when immune cells like lymphocytes and NK cells get activated. Its expression ramps up quickly once these cells are triggered, which is helpful for studying how immune cells behave, especially in conditions of chronic inflammation and autoimmune diseases such as rheumatoid arthritis and lupus. CD69 is also significant in cancer research, where its high levels on CD8⁺ T cells are linked to strong immune responses against tumors. Lowering CD69 can prevent T cell fatigue and boost the immune attack on cancer cells. Additionally, as a part of the C-type lectin family, it plays a role in cell signaling, and researchers make use of recombinant CD69 in crafting antibodies for various experiments to track its presence in tissues. Beyond tracking immune activation, CD69 is crucial in autoimmune disease research. Its unusual expression patterns are tied to the progression of diseases like lupus, hinting at its role in the atypical cell activation in these disorders. Furthermore, CD69 helps control Th17 cell activity and manage allergic and skin reaction limits, making it a key focus in understanding immune regulation and potential therapies. In industrial contexts, recombinant CD69 is produced with genetic techniques in mammalian cell cultures, ensuring it's pure and safe for scientific and diagnostic applications. It’s vital for creating diagnostic tools that measure CD69 during disease and for developing drugs aimed at either adjusting CD69 levels to treat autoimmune diseases or boosting its role to enhance cancer immunity. Overall, CD69 is an essential part of research and drug development centered on immune response and regulation.

Fig1. T cell immune responses mediated by CD69 binding to ligands. (Yuchen Li, 2024)

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD69 Products

Required fields are marked with *

My Review for All CD69 Products

Required fields are marked with *

0
cart-icon
0
compare icon