Recombinant Human CD70 Protein, GST-Tagged
Cat.No. : | CD70-0851H |
Product Overview : | Human CD70 full-length ORF (AAH00725, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 46.86 kDa |
AA Sequence : | MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD70 CD70 molecule [ Homo sapiens ] |
Official Symbol | CD70 |
Synonyms | CD70; CD70 molecule; CD27LG, TNFSF7, tumor necrosis factor (ligand) superfamily, member 7; CD70 antigen; CD27L; CD27-L; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand superfamily member 7; tumor necrosis factor (ligand) superfamily, member 7; CD27LG; TNFSF7; |
Gene ID | 970 |
mRNA Refseq | NM_001252 |
Protein Refseq | NP_001243 |
MIM | 602840 |
UniProt ID | P32970 |
◆ Recombinant Proteins | ||
CD70-891HAF647 | Recombinant Human CD70 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD70-0848H | Recombinant Human CD70 Protein | +Inquiry |
CD70-891H | Recombinant Human CD70 Protein, Fc-tagged | +Inquiry |
CD70-515H | Recombinant Human CD70 Protein (Gln39-Pro193), N-mFc and C-6×His-tagged | +Inquiry |
CD70-5365H | Recombinant Human CD70 Protein (Gln39-Pro193), N-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD70-1303RCL | Recombinant Rat CD70 cell lysate | +Inquiry |
CD70-2710HCL | Recombinant Human CD70 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD70 Products
Required fields are marked with *
My Review for All CD70 Products
Required fields are marked with *