Recombinant Human CD70 Protein, GST-Tagged
| Cat.No. : | CD70-0851H |
| Product Overview : | Human CD70 full-length ORF (AAH00725, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 46.86 kDa |
| AA Sequence : | MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CD70 CD70 molecule [ Homo sapiens ] |
| Official Symbol | CD70 |
| Synonyms | CD70; CD70 molecule; CD27LG, TNFSF7, tumor necrosis factor (ligand) superfamily, member 7; CD70 antigen; CD27L; CD27-L; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand superfamily member 7; tumor necrosis factor (ligand) superfamily, member 7; CD27LG; TNFSF7; |
| Gene ID | 970 |
| mRNA Refseq | NM_001252 |
| Protein Refseq | NP_001243 |
| MIM | 602840 |
| UniProt ID | P32970 |
| ◆ Recombinant Proteins | ||
| CD70-5365H | Recombinant Human CD70 Protein (Gln39-Pro193), N-Fc tagged | +Inquiry |
| CD70-434H | Recombinant Human CD70 protein, His-Flag-tagged | +Inquiry |
| CD70-3055HF | Recombinant Full Length Human CD70 Protein, GST-tagged | +Inquiry |
| CD70-206H | Recombinant Human CD70 Protein, C-His-tagged | +Inquiry |
| Cd70-2065M | Recombinant Mouse Cd70 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD70-1303RCL | Recombinant Rat CD70 cell lysate | +Inquiry |
| CD70-2710HCL | Recombinant Human CD70 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD70 Products
Required fields are marked with *
My Review for All CD70 Products
Required fields are marked with *




