Recombinant Human CD79B Protein, Fc-tagged

Cat.No. : CD79B-171H
Product Overview : Recombinant human CD79B protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 229
Description : The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
Form : Lyophilized
Molecular Mass : 41.8 kDa
AA Sequence : MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens (human) ]
Official Symbol CD79B
Synonyms CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29; Ig-beta; B-cell-specific glycoprotein B29; immunoglobulin-associated B29 protein; CD79b antigen (immunoglobulin-associated beta); IGB; AGM6;
Gene ID 974
mRNA Refseq NM_000626
Protein Refseq NP_000617
MIM 147245
UniProt ID P40259

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD79B Products

Required fields are marked with *

My Review for All CD79B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon