Recombinant Human CD81 Protein, C-His-tagged
Cat.No. : | CD81-210H |
Product Overview : | Recombinant Human CD81 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD81 belongs to the tetraspanin family, which is characterized by four transmembrane domains, one short extracellular domain (ECL1), and one long extracellular domain (ECL2). Tetraspanins interact with a variety of cell surface proteins and intracellular signaling molecules in specialized tetraspanin enriched microdomains (TEMs) where they mediate a range of processes including adhesion, motility, membrane organization, and signal transduction (3). CD81, like other tetraspanins, is enriched in exosomes. Many research studies demonstrate a role for CD81 in lymphocyte signaling. CD81 is also a well-characterized receptor for Hepatitis C Virus and facilitates the entry of the virus into target cells. |
Molecular Mass : | ~10 kDa |
AA Sequence : | FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD81 CD81 molecule [ Homo sapiens (human) ] |
Official Symbol | CD81 |
Synonyms | CD81; CD81 molecule; CD81 antigen (target of antiproliferative 1) , TAPA1; CD81 antigen; TAPA 1; TSPAN28; tspan-28; tetraspanin-28; 26 kDa cell surface protein TAPA-1; CD81 antigen (target of antiproliferative 1); S5.7; CVID6; TAPA1; |
Gene ID | 975 |
mRNA Refseq | NM_004356 |
Protein Refseq | NP_004347 |
MIM | 186845 |
UniProt ID | P60033 |
◆ Recombinant Proteins | ||
CD81-1301H | Recombinant Human CD81 protein(Phe113-Lys201) | +Inquiry |
Cd81-1102R | Recombinant Rat Cd81 protein, mFc-tagged | +Inquiry |
CD81-328C | Recombinant Cynomolgus CD81 Protein, His-tagged | +Inquiry |
CD81-3110M | Recombinant Mouse CD81 Protein | +Inquiry |
CD81-186H | Recombinant Human CD81, Gly&Pro tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD81-848HCL | Recombinant Human CD81 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD81 Products
Required fields are marked with *
My Review for All CD81 Products
Required fields are marked with *