Recombinant Mouse CD81 Protein (116-201 aa), GST-tagged
Cat.No. : | CD81-400M |
Product Overview : | Recombinant Mouse CD81 Protein (116-201 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 116-201 aa |
Description : | May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 36.4 kDa |
AA Sequence : | KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Cd81 CD81 antigen [ Mus musculus ] |
Official Symbol | CD81 |
Synonyms | CD81; CD81 antigen; Tapa1; Tapa-1; Tspan28; |
Gene ID | 12520 |
mRNA Refseq | NM_133655 |
Protein Refseq | NP_598416 |
UniProt ID | P35762 |
◆ Recombinant Proteins | ||
CD81-0268H | Recombinant Human CD81 protein, mFc-tagged | +Inquiry |
CD81-328C | Recombinant Cynomolgus CD81 Protein, His-tagged | +Inquiry |
Cd81-849M | Recombinant Mouse Cd81 Protein, MYC/DDK-tagged | +Inquiry |
CD81-2673H | Recombinant Human CD81 protein, His-SUMO-tagged | +Inquiry |
CD81-210H | Recombinant Human CD81 Protein, C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD81-848HCL | Recombinant Human CD81 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD81 Products
Required fields are marked with *
My Review for All CD81 Products
Required fields are marked with *