Recombinant Human CD81 Protein, GST-Tagged

Cat.No. : CD81-0866H
Product Overview : Human CD81 partial ORF (AAH02978, 25 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Molecular Mass : 36.96 kDa
AA Sequence : GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD81 CD81 molecule [ Homo sapiens ]
Official Symbol CD81
Synonyms CD81; CD81 molecule; CD81 antigen (target of antiproliferative 1), TAPA1; CD81 antigen; TAPA 1; TSPAN28; tspan-28; tetraspanin-28; 26 kDa cell surface protein TAPA-1; CD81 antigen (target of antiproliferative 1); S5.7; CVID6; TAPA1;
Gene ID 975
mRNA Refseq NM_004356
Protein Refseq NP_004347
MIM 186845
UniProt ID P60033

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD81 Products

Required fields are marked with *

My Review for All CD81 Products

Required fields are marked with *

0
cart-icon
0
compare icon