Recombinant Full Length Chlorocebus Aethiops Cd81 Antigen(Cd81) Protein, His-Tagged
Cat.No. : | RFL30843CF |
Product Overview : | Recombinant Full Length Chlorocebus aethiops CD81 antigen(CD81) Protein (O97703) (1-236aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorocebus Aethiops |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-236) |
Form : | Lyophilized powder |
AA Sequence : | MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYV GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLAALTTSVLKNNLCPSGSN IISNLLKKDCHQKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD81 |
Synonyms | CD81; CD81 antigen; CD antigen CD81 |
UniProt ID | O97703 |
◆ Recombinant Proteins | ||
CD81-750R | Recombinant Rhesus monkey CD81 Protein, His-tagged | +Inquiry |
CD81-1469M | Recombinant Mouse CD81 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD81-5374H | Recombinant Human CD81 protein, His-tagged | +Inquiry |
CD81-3943H | Recombinant Human CD81 protein, His&Myc-tagged | +Inquiry |
CD81-574H | Active Recombinant Human CD81 protein, His-Avi&Flag-tagged, Biotinylated(Detergent) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD81-848HCL | Recombinant Human CD81 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD81 Products
Required fields are marked with *
My Review for All CD81 Products
Required fields are marked with *
0
Inquiry Basket