Recombinant Human CD81 protein, His&Myc-tagged
| Cat.No. : | CD81-3943H |
| Product Overview : | Recombinant Human CD81 protein(P60033)(113-201aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 113-201aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK |
| Gene Name | CD81 CD81 molecule [ Homo sapiens ] |
| Official Symbol | CD81 |
| Synonyms | CD81; CD81 molecule; CD81 antigen (target of antiproliferative 1) , TAPA1; CD81 antigen; TAPA 1; TSPAN28; tspan-28; tetraspanin-28; 26 kDa cell surface protein TAPA-1; CD81 antigen (target of antiproliferative 1); S5.7; CVID6; TAPA1; |
| Gene ID | 975 |
| mRNA Refseq | NM_004356 |
| Protein Refseq | NP_004347 |
| MIM | 186845 |
| UniProt ID | P60033 |
| ◆ Recombinant Proteins | ||
| CD81-328C | Recombinant Cynomolgus CD81 Protein, His-tagged | +Inquiry |
| Cd81-1102R | Recombinant Rat Cd81 protein, mFc-tagged | +Inquiry |
| CD81-576R | Recombinant Rhesus Macaque CD81 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD81-01H | Active Recombinant Human CD81 Protein, Fc-tagged | +Inquiry |
| CD81-921R | Recombinant Rat CD81 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD81-848HCL | Recombinant Human CD81 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD81 Products
Required fields are marked with *
My Review for All CD81 Products
Required fields are marked with *



