Recombinant Human CD81 protein, His-SUMO-tagged
Cat.No. : | CD81-2673H |
Product Overview : | Recombinant Human CD81 protein(P60033)(113-201aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 113-201aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.8 kDa |
AA Sequence : | FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CD81 CD81 molecule [ Homo sapiens ] |
Official Symbol | CD81 |
Synonyms | CD81; CD81 molecule; CD81 antigen (target of antiproliferative 1) , TAPA1; CD81 antigen; TAPA 1; TSPAN28; tspan-28; tetraspanin-28; 26 kDa cell surface protein TAPA-1; CD81 antigen (target of antiproliferative 1); S5.7; CVID6; TAPA1; |
Gene ID | 975 |
mRNA Refseq | NM_004356 |
Protein Refseq | NP_004347 |
MIM | 186845 |
UniProt ID | P60033 |
◆ Recombinant Proteins | ||
CD81-574H | Active Recombinant Human CD81 protein, His-Avi&Flag-tagged, Biotinylated(Detergent) | +Inquiry |
Cd81-849M | Recombinant Mouse Cd81 Protein, MYC/DDK-tagged | +Inquiry |
CD81-247H | Recombinant Human CD81 protein, His-tagged | +Inquiry |
CD81-548H | Recombinant Human CD81 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD81-210H | Recombinant Human CD81 Protein, C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD81-848HCL | Recombinant Human CD81 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD81 Products
Required fields are marked with *
My Review for All CD81 Products
Required fields are marked with *