Recombinant Human CD81 protein, His-tagged
Cat.No. : | CD81-3465H |
Product Overview : | Recombinant Human CD81 protein(114-199 aa), fused to His tag, was expressed in E. coli. |
Availability | October 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 114-199 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CD81 CD81 molecule [ Homo sapiens ] |
Official Symbol | CD81 |
Synonyms | CD81; CD81 molecule; CD81 antigen (target of antiproliferative 1) , TAPA1; CD81 antigen; TAPA 1; TSPAN28; tspan-28; tetraspanin-28; 26 kDa cell surface protein TAPA-1; CD81 antigen (target of antiproliferative 1); S5.7; CVID6; TAPA1; |
Gene ID | 975 |
mRNA Refseq | NM_004356 |
Protein Refseq | NP_004347 |
MIM | 186845 |
UniProt ID | P60033 |
◆ Recombinant Proteins | ||
Cd81-849M | Recombinant Mouse Cd81 Protein, MYC/DDK-tagged | +Inquiry |
CD81-400M | Recombinant Mouse CD81 Protein (116-201 aa), GST-tagged | +Inquiry |
Cd81-1102R | Recombinant Rat Cd81 protein, mFc-tagged | +Inquiry |
CD81-210H | Recombinant Human CD81 Protein, C-His-tagged | +Inquiry |
CD81-0866H | Recombinant Human CD81 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD81-848HCL | Recombinant Human CD81 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD81 Products
Required fields are marked with *
My Review for All CD81 Products
Required fields are marked with *