Recombinant Human CD8A protein, His-SUMO-tagged
Cat.No. : | CD8A-2675H |
Product Overview : | Recombinant Human CD8A protein(P01732)(22-182), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-182 |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.6 kDa |
AA Sequence : | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CD8A CD8a molecule [ Homo sapiens ] |
Official Symbol | CD8A |
Synonyms | CD8A; CD8a molecule; CD8, CD8 antigen, alpha polypeptide (p32) , T cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 alpha chain; T8 T-cell antigen; T cell co-receptor; OKT8 T-cell antigen; T-cell antigen Leu2; Leu2 T-lymphocyte antigen; CD8 antigen, alpha polypeptide (p32); T-lymphocyte differentiation antigen T8/Leu-2; CD8; MAL; p32; Leu2; |
Gene ID | 925 |
mRNA Refseq | NM_001145873 |
Protein Refseq | NP_001139345 |
MIM | 186910 |
UniProt ID | P01732 |
◆ Recombinant Proteins | ||
CD8A-274H | Recombinant Human CD8A protein, His-tagged | +Inquiry |
CD8A-5302H | Recombinant Human CD8A Protein (Met1-Asp182), C-His tagged | +Inquiry |
Cd8a-422G | Recombinant Golden hamster Cd8a protein, His&Strep II-tagged | +Inquiry |
CD8A-1670H | Recombinant Human CD8A protein, His-Avi-tagged, Biotinylated | +Inquiry |
CD8A-1974R | Recombinant Rat CD8A protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8A-1872FCL | Recombinant Ferret CD8A cell lysate | +Inquiry |
CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
CD8A-2514MCL | Recombinant Mouse CD8A cell lysate | +Inquiry |
CD8A-827RCL | Recombinant Rat CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD8A Products
Required fields are marked with *
My Review for All CD8A Products
Required fields are marked with *
0
Inquiry Basket