Recombinant Human CD8a Protein, His-tagged

PRODUCTS

Home / Products / Recombinant Human CD8a Protein, His-tagged

Recombinant Human CD8a Protein, His-tagged

CD8A Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD8A-1158H
Product Overview : Recombinant Human CD8a Protein (22-182aa) was expressed in Yeast with N-terminal 6xHis-tag.
Source : Yeast
Species : Human
Tag : His
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 19.6 kDa
AA Sequence : SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSG
KRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRP
EACRPAAGGAVHTRGLDFACD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Figure :

Gene Name : CD8A CD8a molecule [ Homo sapiens ]
Official Symbol : CD8A
Synonyms : CD8A; CD8a molecule; CD8, CD8 antigen, alpha polypeptide (p32) , T cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 alpha chain; T8 T-cell antigen; T cell co-receptor; OKT8 T-cell antigen; T-cell antigen Leu2; Leu2 T-lymphocyte antigen; CD8 antigen, alpha polypeptide (p32); T-lymphocyte differentiation antigen T8/Leu-2; CD8; MAL; p32; Leu2
Gene ID : 925
mRNA Refseq : NM_001145873
Protein Refseq : NP_001139345
MIM : 186910
UniProt ID : P01732

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.