Recombinant Human CD8a Protein, His-tagged
Cat.No. : | CD8A-1158H |
Product Overview : | Recombinant Human CD8a Protein (22-182aa) was expressed in Yeast with N-terminal 6xHis-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 22-182 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 19.6 kDa |
AA Sequence : | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSG KRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRP EACRPAAGGAVHTRGLDFACD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | CD8A CD8a molecule [ Homo sapiens ] |
Official Symbol | CD8A |
Synonyms | CD8A; CD8a molecule; CD8, CD8 antigen, alpha polypeptide (p32) , T cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 alpha chain; T8 T-cell antigen; T cell co-receptor; OKT8 T-cell antigen; T-cell antigen Leu2; Leu2 T-lymphocyte antigen; CD8 antigen, alpha polypeptide (p32); T-lymphocyte differentiation antigen T8/Leu-2; CD8; MAL; p32; Leu2 |
Gene ID | 925 |
mRNA Refseq | NM_001145873 |
Protein Refseq | NP_001139345 |
MIM | 186910 |
UniProt ID | P01732 |
◆ Cell & Tissue Lysates | ||
CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
CD8A-2514MCL | Recombinant Mouse CD8A cell lysate | +Inquiry |
CD8A-1872FCL | Recombinant Ferret CD8A cell lysate | +Inquiry |
CD8A-827RCL | Recombinant Rat CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD8A Products
Required fields are marked with *
My Review for All CD8A Products
Required fields are marked with *