Recombinant Human CD8a Protein, His-tagged

Cat.No. : CD8A-1158H
Product Overview : Recombinant Human CD8a Protein (22-182aa) was expressed in Yeast with N-terminal 6xHis-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 22-182 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 19.6 kDa
AA Sequence : SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSG
KRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRP
EACRPAAGGAVHTRGLDFACD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name CD8A CD8a molecule [ Homo sapiens ]
Official Symbol CD8A
Synonyms CD8A; CD8a molecule; CD8, CD8 antigen, alpha polypeptide (p32) , T cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 alpha chain; T8 T-cell antigen; T cell co-receptor; OKT8 T-cell antigen; T-cell antigen Leu2; Leu2 T-lymphocyte antigen; CD8 antigen, alpha polypeptide (p32); T-lymphocyte differentiation antigen T8/Leu-2; CD8; MAL; p32; Leu2
Gene ID 925
mRNA Refseq NM_001145873
Protein Refseq NP_001139345
MIM 186910
UniProt ID P01732

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD8A Products

Required fields are marked with *

My Review for All CD8A Products

Required fields are marked with *

0
cart-icon