Recombinant Human CD8B protein, His-tagged
| Cat.No. : | CD8B-3819H |
| Product Overview : | Recombinant Human CD8B protein(22-171 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 24, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 22-171 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CD8B CD8b molecule [ Homo sapiens ] |
| Official Symbol | CD8B |
| Synonyms | CD8B; CD8b molecule; CD8 antigen, beta polypeptide 1 (p37) , CD8B1; T-cell surface glycoprotein CD8 beta chain; CD8 antigen, beta polypeptide 1 (p37); T lymphocyte surface glycoprotein beta chain; LY3; P37; LEU2; LYT3; CD8B1; MGC119115; |
| Gene ID | 926 |
| mRNA Refseq | NM_001178100 |
| Protein Refseq | NP_001171571 |
| MIM | 186730 |
| UniProt ID | P10966 |
| ◆ Recombinant Proteins | ||
| CD8B-1265R | Recombinant Rat CD8B Protein | +Inquiry |
| CD8B-5024H | Recombinant Human CD8B, His-tagged | +Inquiry |
| CD8B-270H | Recombinant Human CD8B Protein, Fc-tagged | +Inquiry |
| CD8B-3819H | Recombinant Human CD8B protein, His-tagged | +Inquiry |
| CD8B-3091HF | Recombinant Full Length Human CD8B Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD8B-001HCL | Recombinant Human CD8B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD8B Products
Required fields are marked with *
My Review for All CD8B Products
Required fields are marked with *
