Recombinant Human CD8B Protein, GST-Tagged
Cat.No. : | CD8B-0880H |
Product Overview : | Human CD8B1 full-length ORF (NP_757362.1, 1 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. [provided by RefSeq, May 2010] |
Molecular Mass : | 53.6 kDa |
AA Sequence : | MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD8B CD8b molecule [ Homo sapiens ] |
Official Symbol | CD8B |
Synonyms | CD8B; CD8b molecule; CD8 antigen, beta polypeptide 1 (p37), CD8B1; T-cell surface glycoprotein CD8 beta chain; CD8 antigen, beta polypeptide 1 (p37); T lymphocyte surface glycoprotein beta chain; LY3; P37; LEU2; LYT3; CD8B1; MGC119115; |
Gene ID | 926 |
mRNA Refseq | NM_001178100 |
Protein Refseq | NP_001171571 |
MIM | 186730 |
UniProt ID | P10966 |
◆ Recombinant Proteins | ||
CD8B-270H | Recombinant Human CD8B Protein, Fc-tagged | +Inquiry |
CD8B-923R | Recombinant Rat CD8B Protein, His (Fc)-Avi-tagged | +Inquiry |
CD8B-3819H | Recombinant Human CD8B protein, His-tagged | +Inquiry |
CD8B-26H | Recombinant Human CD8B Protein, His-tagged | +Inquiry |
CD8B-423H | Recombinant Human CD8b molecule, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8B-001HCL | Recombinant Human CD8B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD8B Products
Required fields are marked with *
My Review for All CD8B Products
Required fields are marked with *
0
Inquiry Basket