Recombinant Mouse Cd9 Full Length Transmembrane protein, His-tagged
| Cat.No. : | Cd9-1333M |
| Product Overview : | Recombinant Mouse Cd9 protein(P40240)(1-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-226aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.1 kDa |
| AA Sequence : | MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Cd9 CD9 antigen [ Mus musculus ] |
| Official Symbol | Cd9 |
| Synonyms | CD9; CD9 antigen; Tspan29; |
| Gene ID | 12527 |
| mRNA Refseq | NM_007657 |
| Protein Refseq | NP_031683 |
| ◆ Recombinant Proteins | ||
| RFL13136CF | Recombinant Full Length Chlorocebus Aethiops Cd9 Antigen(Cd9) Protein, His-Tagged | +Inquiry |
| CD9-6464H | Recombinant Human CD9 protein, His&Myc-tagged | +Inquiry |
| CD9-178H | Recombinant Human CD9 Protein, C-His-tagged | +Inquiry |
| CD9-753R | Recombinant Rhesus monkey CD9 Protein, His-tagged | +Inquiry |
| RFL12219MF | Recombinant Full Length Mouse Cd9 Antigen(Cd9) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD9-2110HCL | Recombinant Human CD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd9 Products
Required fields are marked with *
My Review for All Cd9 Products
Required fields are marked with *
