Recombinant Mouse Cd9 Full Length Transmembrane protein, His-tagged
Cat.No. : | Cd9-1333M |
Product Overview : | Recombinant Mouse Cd9 protein(P40240)(1-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-226aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.1 kDa |
AA Sequence : | MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cd9 CD9 antigen [ Mus musculus ] |
Official Symbol | Cd9 |
Synonyms | CD9; CD9 antigen; Tspan29; |
Gene ID | 12527 |
mRNA Refseq | NM_007657 |
Protein Refseq | NP_031683 |
◆ Native Proteins | ||
TF-136C | Native Chicken Ovotransferrin | +Inquiry |
ASOM-37 | Active Native L-ascorbate oxidase | +Inquiry |
LH-92P | Native Porcine LH | +Inquiry |
Collagen-48H | Native Human Collagen V | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPT2-2905HCL | Recombinant Human PPT2 293 Cell Lysate | +Inquiry |
CTSL1-3022HCL | Recombinant Human CTSL1 cell lysate | +Inquiry |
ARPC4-8684HCL | Recombinant Human ARPC4 293 Cell Lysate | +Inquiry |
MCF-7-006HCL | Human MCF-7 Whole Cell Lysate | +Inquiry |
ICAM2-2427HCL | Recombinant Human ICAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd9 Products
Required fields are marked with *
My Review for All Cd9 Products
Required fields are marked with *
0
Inquiry Basket