Recombinant Human CDC20 Protein, GST-Tagged
Cat.No. : | CDC20-0910H |
Product Overview : | Human CDC20 full-length ORF (AAH00624.1, 1 a.a. - 499 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 81.2 kDa |
AA Sequence : | MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWVLNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC20 cell division cycle 20 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC20 |
Synonyms | CDC20; cell division cycle 20 homolog (S. cerevisiae); CDC20 (cell division cycle 20, S. cerevisiae, homolog), CDC20 cell division cycle 20 homolog (S. cerevisiae); cell division cycle protein 20 homolog; CDC20A; p55CDC; CDC20 cell division cycle 20 homolog; bA276H19.3; MGC102824; |
Gene ID | 991 |
mRNA Refseq | NM_001255 |
Protein Refseq | NP_001246 |
MIM | 603618 |
UniProt ID | Q12834 |
◆ Recombinant Proteins | ||
CDC20-1270R | Recombinant Rat CDC20 Protein | +Inquiry |
CDC20-1674C | Recombinant Chicken CDC20 | +Inquiry |
CDC20-553H | Recombinant Human CDC20 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC20-0910H | Recombinant Human CDC20 Protein, GST-Tagged | +Inquiry |
CDC20-758R | Recombinant Rhesus monkey CDC20 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC20-7668HCL | Recombinant Human CDC20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDC20 Products
Required fields are marked with *
My Review for All CDC20 Products
Required fields are marked with *
0
Inquiry Basket