Recombinant Human CDC20 protein, His&Myc-tagged
Cat.No. : | CDC20-5841H |
Product Overview : | Recombinant Human CDC20 protein(Q12834)(1-499aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-499aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 62.2 kDa |
AA Sequence : | MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CDC20 cell division cycle 20 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC20 |
Synonyms | CDC20; cell division cycle 20 homolog (S. cerevisiae); CDC20 (cell division cycle 20, S. cerevisiae, homolog) , CDC20 cell division cycle 20 homolog (S. cerevisiae); cell division cycle protein 20 homolog; CDC20A; p55CDC; CDC20 cell division cycle 20 homolog; bA276H19.3; MGC102824; |
Gene ID | 991 |
mRNA Refseq | NM_001255 |
Protein Refseq | NP_001246 |
MIM | 603618 |
UniProt ID | Q12834 |
◆ Recombinant Proteins | ||
CDC20-12309Z | Recombinant Zebrafish CDC20 | +Inquiry |
CDC20-27897TH | Recombinant Human CDC20 | +Inquiry |
CDC20-1674C | Recombinant Chicken CDC20 | +Inquiry |
CDC20-1042HFL | Recombinant Full Length Human CDC20 Protein, C-Flag-tagged | +Inquiry |
CDC20-1270R | Recombinant Rat CDC20 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC20-7668HCL | Recombinant Human CDC20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC20 Products
Required fields are marked with *
My Review for All CDC20 Products
Required fields are marked with *