"CDC42" Related Products

Expand
Expand
Expand

Recombinant Human CDC42 Protein, GST-Tagged

Cat.No.: CDC42-0934H
Product Overview: Human CDC42 full-length ORF (AAH02711, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20. [provided by RefSeq, Apr 2013]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 46.75 kDa
AA Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: CDC42 cell division cycle 42 (GTP binding protein, 25kDa) [ Homo sapiens ]
Official Symbol: CDC42
Synonyms: CDC42; cell division cycle 42 (GTP binding protein, 25kDa); cell division cycle 42 (GTP binding protein, 25kD); cell division control protein 42 homolog; CDC42Hs; G25K; G25K GTP-binding protein; GTP-binding protein, 25kD; growth-regulating protein; small GTP binding protein CDC42; dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD)); dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD));
Gene ID: 998
mRNA Refseq: NM_001039802
Protein Refseq: NP_001034891
MIM: 116952
UniProt ID: P60953

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.