Recombinant Human CDC42 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CDC42-1712H |
Product Overview : | CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_426359) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20. |
Molecular Mass : | 21.1 kDa |
AA Sequence : | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPPETQPKRKCCIFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CDC42 cell division cycle 42 [ Homo sapiens (human) ] |
Official Symbol | CDC42 |
Synonyms | CDC42; cell division cycle 42 (GTP binding protein, 25kDa); cell division cycle 42 (GTP binding protein, 25kD); cell division control protein 42 homolog; CDC42Hs; G25K; G25K GTP-binding protein; GTP-binding protein, 25kD; growth-regulating protein; small GTP binding protein CDC42; dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD)); dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD)); |
Gene ID | 998 |
mRNA Refseq | NM_044472 |
Protein Refseq | NP_426359 |
MIM | 116952 |
UniProt ID | P60953 |
◆ Recombinant Proteins | ||
CDC42-2636H | Active Recombinant Human CDC42(T17N) protein, GST-tagged | +Inquiry |
CDC42-26610TH | Recombinant Human CDC42 | +Inquiry |
CDC42-1484M | Recombinant Mouse CDC42 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC42-763R | Recombinant Rhesus monkey CDC42 Protein, His-tagged | +Inquiry |
CDC42-07HFL | Recombinant Full Length Human CDC42 Protein, C-Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC42-7655HCL | Recombinant Human CDC42 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDC42 Products
Required fields are marked with *
My Review for All CDC42 Products
Required fields are marked with *
0
Inquiry Basket