Recombinant Human CDC42BPA Protein, GST-Tagged
Cat.No. : | CDC42BPA-0939H |
Product Overview : | Human CDC42BPA partial ORF (NP_003598, 551 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the Serine/Threonine protein kinase family. This kinase contains multiple functional domains. Its kinase domain is highly similar to that of the myotonic dystrophy protein kinase (DMPK). This kinase also contains a Rac interactive binding (CRIB) domain, and has been shown to bind CDC42. It may function as a CDC42 downstream effector mediating CDC42 induced peripheral actin formation, and promoting cytoskeletal reorganization. Multiple alternatively spliced transcript variants have been described, and the full-length nature of two of them has been reported. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLRE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC42BPA CDC42 binding protein kinase alpha (DMPK-like) [ Homo sapiens ] |
Official Symbol | CDC42BPA |
Synonyms | CDC42BPA; CDC42 binding protein kinase alpha (DMPK-like); CDC42 binding protein kinase alpha (DMPK like); serine/threonine-protein kinase MRCK alpha; FLJ23347; KIAA0451; MRCK; MRCKA; myotonic dystrophy kinase related Cdc42 binding kinase; PK428; MRCK alpha; DMPK-like alpha; ser-thr protein kinase PK428; CDC42 binidng protein kinase beta; myotonic dystrophy protein kinase-like alpha; CDC42-binding protein kinase alpha (DMPK-like); myotonic dystrophy kinase-related CDC42-binding kinase alpha; myotonic dystrophy kinase-related CDC42-binding protein kinase alpha; ser-thr protein kinase related to the myotonic dystrophy protein kinase; DKFZp686L1738; DKFZp686P1738; |
Gene ID | 8476 |
mRNA Refseq | NM_003607 |
Protein Refseq | NP_003598 |
MIM | 603412 |
UniProt ID | Q5VT25 |
◆ Recombinant Proteins | ||
CDC42BPA-0938H | Active Recombinant Human CDC42BPA Protein, GST-Tagged | +Inquiry |
CDC42BPA-0939H | Recombinant Human CDC42BPA Protein, GST-Tagged | +Inquiry |
CDC42BPA-357H | Recombinant Human CDC42BPA, GST-tagged, Active | +Inquiry |
CDC42BPA-368H | Recombinant Human CDC42 Binding Protein Kinase Alpha (DMPK-like), His-tagged | +Inquiry |
CDC42BPA-1278R | Recombinant Rat CDC42BPA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC42BPA-7654HCL | Recombinant Human CDC42BPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC42BPA Products
Required fields are marked with *
My Review for All CDC42BPA Products
Required fields are marked with *