Recombinant Human CDC42BPG Protein, GST-Tagged
Cat.No. : | CDC42BPG-0943H |
Product Overview : | Human CDC42BPG partial ORF (NP_059995, 1423 a.a. - 1528 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CDC42BPG (CDC42 Binding Protein Kinase Gamma) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDC42BPA. |
Molecular Mass : | 37.4 kDa |
AA Sequence : | RREMLKDPFVRSKLISPPTNFNHLVHVGPANGRPGARDKSPAPEEKGRVARGSGPQRPHSFSEALRRPASMGSEGLGGDADPMKRKPWTSLSSESVSCPQGSLSPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC42BPG CDC42 binding protein kinase gamma (DMPK-like) [ Homo sapiens ] |
Official Symbol | CDC42BPG |
Synonyms | CDC42BPG; CDC42 binding protein kinase gamma (DMPK-like); serine/threonine-protein kinase MRCK gamma; DMPK2; HSMDPKIN; kappa 200; MRCKgamma; MRCK gamma; DMPK-like gamma; CDC42-binding protein kinase gamma; myotonic dystrophy protein kinase-like alpha; myotonic dystrophy protein kinase-like gamma; myotonic dystrophy protein kinase like protein; myotonic dystrophy kinase-related CDC42-binding kinase gamma; MRCKG; KAPPA-200; |
Gene ID | 55561 |
mRNA Refseq | NM_017525 |
Protein Refseq | NP_059995 |
MIM | 613991 |
UniProt ID | Q6DT37 |
◆ Recombinant Proteins | ||
CDC42BPG-0943H | Recombinant Human CDC42BPG Protein, GST-Tagged | +Inquiry |
CDC42BPG-0942H | Active Recombinant Human CDC42BPG Protein, GST-Tagged | +Inquiry |
CDC42BPG-1486M | Recombinant Mouse CDC42BPG Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC42BPG-3142M | Recombinant Mouse CDC42BPG Protein | +Inquiry |
CDC42BPG-1396H | Active Recombinant Human DMPK, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC42BPG Products
Required fields are marked with *
My Review for All CDC42BPG Products
Required fields are marked with *