Recombinant Human CDC42BPG Protein, GST-Tagged

Cat.No. : CDC42BPG-0943H
Product Overview : Human CDC42BPG partial ORF (NP_059995, 1423 a.a. - 1528 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CDC42BPG (CDC42 Binding Protein Kinase Gamma) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDC42BPA.
Molecular Mass : 37.4 kDa
AA Sequence : RREMLKDPFVRSKLISPPTNFNHLVHVGPANGRPGARDKSPAPEEKGRVARGSGPQRPHSFSEALRRPASMGSEGLGGDADPMKRKPWTSLSSESVSCPQGSLSPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDC42BPG CDC42 binding protein kinase gamma (DMPK-like) [ Homo sapiens ]
Official Symbol CDC42BPG
Synonyms CDC42BPG; CDC42 binding protein kinase gamma (DMPK-like); serine/threonine-protein kinase MRCK gamma; DMPK2; HSMDPKIN; kappa 200; MRCKgamma; MRCK gamma; DMPK-like gamma; CDC42-binding protein kinase gamma; myotonic dystrophy protein kinase-like alpha; myotonic dystrophy protein kinase-like gamma; myotonic dystrophy protein kinase like protein; myotonic dystrophy kinase-related CDC42-binding kinase gamma; MRCKG; KAPPA-200;
Gene ID 55561
mRNA Refseq NM_017525
Protein Refseq NP_059995
MIM 613991
UniProt ID Q6DT37

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC42BPG Products

Required fields are marked with *

My Review for All CDC42BPG Products

Required fields are marked with *

0
cart-icon