Recombinant Human CDC42BPG Protein, GST-Tagged

• Cat.No.: CDC42BPG-0943H
• Product Overview: Human CDC42BPG partial ORF (NP_059995, 1423 a.a. - 1528 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CDC42BPG (CDC42 Binding Protein Kinase Gamma) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDC42BPA.
• Molecular Mass: 37.4 kDa
• AA Sequence: RREMLKDPFVRSKLISPPTNFNHLVHVGPANGRPGARDKSPAPEEKGRVARGSGPQRPHSFSEALRRPASMGSEGLGGDADPMKRKPWTSLSSESVSCPQGSLSPA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDC42BPG CDC42 binding protein kinase gamma (DMPK-like) [ Homo sapiens ]
• Official Symbol: CDC42BPG
• Synonyms: CDC42BPG; CDC42 binding protein kinase gamma (DMPK-like); serine/threonine-protein kinase MRCK gamma; DMPK2; HSMDPKIN; kappa 200; MRCKgamma; MRCK gamma; DMPK-like gamma; CDC42-binding protein kinase gamma; myotonic dystrophy protein kinase-like alpha; myotonic dystrophy protein kinase-like gamma; myotonic dystrophy protein kinase like protein; myotonic dystrophy kinase-related CDC42-binding kinase gamma; MRCKG; KAPPA-200
• Gene ID: 55561
• mRNA Refseq: NM_017525
• Protein Refseq: NP_059995
• MIM: 613991
• UniProt ID: Q6DT37