Recombinant Human CDH1 protein(791-880 aa), C-His-tagged
Cat.No. : | CDH1-2645H |
Product Overview : | Recombinant Human CDH1 protein(P12830)(791-880 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 791-880 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGE |
Gene Name | CDH1 cadherin 1, type 1, E-cadherin (epithelial) [ Homo sapiens ] |
Official Symbol | CDH1 |
Synonyms | CDH1; cadherin 1, type 1, E-cadherin (epithelial); UVO; cadherin-1; CD324; E Cadherin; uvomorulin; CAM 120/80; E-Cadherin; cell-CAM 120/80; epithelial cadherin; cadherin 1, E-cadherin (epithelial); calcium-dependent adhesion protein, epithelial; CDHE; ECAD; LCAM; Arc-1; |
Gene ID | 999 |
mRNA Refseq | NM_004360 |
Protein Refseq | NP_004351 |
MIM | 192090 |
UniProt ID | P12830 |
◆ Recombinant Proteins | ||
CDH1-278H | Recombinant Human CDH1, StrepII-tagged | +Inquiry |
CDH1-26935TH | Recombinant Human CDH1 | +Inquiry |
CDH1-0969H | Recombinant Human CDH1 Protein, GST-Tagged | +Inquiry |
CDH1-689H | Recombinant Human CDH1, His tagged | +Inquiry |
CDH1-214H | Recombinant Human CDH1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH1-1892MCL | Recombinant Mouse CDH1 cell lysate | +Inquiry |
CDH1-938HCL | Recombinant Human CDH1 cell lysate | +Inquiry |
CDH1-736RCL | Recombinant Rat CDH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH1 Products
Required fields are marked with *
My Review for All CDH1 Products
Required fields are marked with *