Recombinant Human CDH1 protein(791-880 aa), C-His-tagged
| Cat.No. : | CDH1-2645H |
| Product Overview : | Recombinant Human CDH1 protein(P12830)(791-880 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 791-880 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | LMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGE |
| Gene Name | CDH1 cadherin 1, type 1, E-cadherin (epithelial) [ Homo sapiens ] |
| Official Symbol | CDH1 |
| Synonyms | CDH1; cadherin 1, type 1, E-cadherin (epithelial); UVO; cadherin-1; CD324; E Cadherin; uvomorulin; CAM 120/80; E-Cadherin; cell-CAM 120/80; epithelial cadherin; cadherin 1, E-cadherin (epithelial); calcium-dependent adhesion protein, epithelial; CDHE; ECAD; LCAM; Arc-1; |
| Gene ID | 999 |
| mRNA Refseq | NM_004360 |
| Protein Refseq | NP_004351 |
| MIM | 192090 |
| UniProt ID | P12830 |
| ◆ Recombinant Proteins | ||
| CDH1-2677H | Recombinant Human CDH1 protein, His-tagged | +Inquiry |
| RFL24889GF | Recombinant Full Length Chicken Cadherin-1(Cdh1) Protein, His-Tagged | +Inquiry |
| CDH1-0939H | Recombinant Human CDH1 Protein (Asp155-Asp367), N-His tagged | +Inquiry |
| CDH1-1438C | Recombinant Cynomolgus CDH1 protein, His-tagged | +Inquiry |
| CDH1-558H | Recombinant Human CDH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDH1-1892MCL | Recombinant Mouse CDH1 cell lysate | +Inquiry |
| CDH1-736RCL | Recombinant Rat CDH1 cell lysate | +Inquiry |
| CDH1-938HCL | Recombinant Human CDH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH1 Products
Required fields are marked with *
My Review for All CDH1 Products
Required fields are marked with *
