"CDH1" Related Products

Expand
Expand
Expand

Recombinant Human CDH1 protein, His-tagged

Cat.No.: CDH1-691H
Product Overview: Recombinant Human CDH1(Gln 23 - Phe 647) fused with His tag at C-terminal was expressed in HEK293.
Source: HEK293
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
Protein length: Gln23-Phe647
AA Sequence: QEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKR PLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQ KRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVT EPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVM EVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPAYTLVVQA ADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAV YTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDV LDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAI STRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNP KPQVINIIDADLPPILASQSIGITDMSHCTCPAPQLPAIFVDHHHHHH*
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 4 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 2X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: CDH1 cadherin 1, type 1, E-cadherin (epithelial) [ Homo sapiens ]
Official Symbol: CDH1
Synonyms: CDH1; cadherin 1, type 1, E-cadherin (epithelial); UVO; cadherin-1; CD324; E Cadherin; uvomorulin; CAM 120/80; E-Cadherin; cell-CAM 120/80; epithelial cadherin; cadherin 1, E-cadherin (epithelial); calcium-dependent adhesion protein, epithelial; CDHE; ECAD; LCAM; Arc-1;
Gene ID: 999
mRNA Refseq: NM_004360
Protein Refseq: NP_004351
MIM: 192090
UniProt ID: P12830
Chromosome Location: 16q22.1
Pathway: Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cell adhesionproteins, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem;
Function: GTPase activating protein binding; calcium ion binding; cell adhesion molecule binding; gamma-catenin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.