Recombinant Human CDH18 protein, T7/His-tagged
Cat.No. : | CDH18-47H |
Product Overview : | Recombinant extracellular domain of human CDH18 gene (54-608 aa) fused with 29 N-terminal T7/His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 54-608 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFGWVWNQFFVLEEHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGT IFIIDDTTGDIHSTKSLDREQKTHYVLHAQAIDRRTNKPLEPESEFIIKVQDINDNAPKFTDGPYIVTVPEMSDM GTSVLQVTATDADDPTYGNSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSVVIQAKDMAGQVGGLS GSTTVNITLTDVNDNPPRFPQKHYQLYVPESAQVGSAVGKIKANDADTGSNADMTYSIINGDGMGIFSISTDKET REGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSHLGPFKDATMLKIIVGDVDEPPLFSMPSYLMEVYENAKIG TVVGTVLAQDPDSTNSLVRYFINYNVEDDRFFNIDANTGTIRTTKVLDREETPWYNITVTASEIDNPDLLSHVTV GIRVLDVNDNPPELAREYDIIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNFTLKDNEDNTASI LTRRRRFSRTVQDVYYLPIMISDGGIPSLSSSSTLTIRVCACERDGRVRTCHAEAFLSS |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein can be used as coating matrix protein for study human neuronal cell / Recceptor interaction in vitro.2. As highly purified protein, may be used as culture matrix protein for human neuronal axon connection study in vitro. |
Storage : | Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CDH18 cadherin 18, type 2 [ Homo sapiens ] |
Official Symbol | CDH18 |
Synonyms | CDH18; cadherin 18, type 2; cadherin-18; CDH14; EY CADHERIN; cadherin-14; ey-cadherin; cadherin-like 24; CDH24; CDH14L; |
Gene ID | 1016 |
mRNA Refseq | NM_001167667 |
Protein Refseq | NP_001161139 |
MIM | 603019 |
UniProt ID | Q13634 |
Chromosome Location | 5p14.3 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
CDH18-3139HF | Recombinant Full Length Human CDH18 Protein, GST-tagged | +Inquiry |
CDH18-097R | Recombinant Rhesus CDH18 protein, His-tagged | +Inquiry |
CDH18-11034H | Recombinant Human CDH18, GST-tagged | +Inquiry |
CDH18-718H | Recombinant Human CDH18 Protein, His-tagged | +Inquiry |
CDH18-85C | Recombinant Cynomolgus CDH18, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH18-765CCL | Recombinant Cynomolgus CDH18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH18 Products
Required fields are marked with *
My Review for All CDH18 Products
Required fields are marked with *