Recombinant Human CDH22 protein, His-tagged
Cat.No. : | CDH22-721H |
Product Overview : | Recombinant Human CDH22 protein(Q9UJ99)(Met281-Glu390), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Met281-Glu390 |
Form : | Phosphate buffered saline |
Storage : | Store at -20°C to -80°C. |
Molecular Mass : | 14 kDa |
AA Sequence : | MYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYHLKDESSSGGDVFKVTTDSDTQEAIIVVQKRLDFESQPVHTVILEALNKFVDPRFADLGTFRDQAIVRVAVTDVDE |
◆ Recombinant Proteins | ||
CDH22-5180H | Recombinant Human CDH22 Protein, GST-tagged | +Inquiry |
CDH22-950R | Recombinant Rat CDH22 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH22-1292R | Recombinant Rat CDH22 Protein | +Inquiry |
CDH22-721H | Recombinant Human CDH22 protein, His-tagged | +Inquiry |
CDH22-720H | Recombinant Human CDH22 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH22 Products
Required fields are marked with *
My Review for All CDH22 Products
Required fields are marked with *