Recombinant Human CDH22 Protein, GST-tagged
Cat.No. : | CDH22-5180H |
Product Overview : | Human CDH22 partial ORF ( NP_067071, 274 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the cadherin superfamily. The gene product is composed of five cadherin repeat domains and a cytoplasmic tail similar to the highly conserved cytoplasmic region of classical cadherins. Expressed predominantly in the brain, this putative calcium-dependent cell adhesion protein may play an important role in morphogenesis and tissue formation in neural and non-neural cells during development and maintenance of the brain and neuroendocrine organs. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | PPRFPQKMYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYHLKDESSSGGDVFKVTTDSDTQEAIIVVQKRLDFESQPVHTVILEALNKFVDPRFADLGTFRDQAIVRV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDH22 cadherin 22 [ Homo sapiens (human) ] |
Official Symbol | CDH22 |
Synonyms | CDH22; cadherin 22; C20orf25; dJ998H6.1; cadherin-22; PB-cadherin; cadherin 22, type 2; cadherin-like 22; ortholog of rat PB-cadherin; pituitary and brain cadherin |
Gene ID | 64405 |
mRNA Refseq | NM_021248 |
Protein Refseq | NP_067071 |
MIM | 609920 |
UniProt ID | Q9UJ99 |
◆ Recombinant Proteins | ||
CDH22-5180H | Recombinant Human CDH22 Protein, GST-tagged | +Inquiry |
CDH22-950R | Recombinant Rat CDH22 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH22-721H | Recombinant Human CDH22 protein, His-tagged | +Inquiry |
CDH22-720H | Recombinant Human CDH22 Protein, His-tagged | +Inquiry |
CDH22-1292R | Recombinant Rat CDH22 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH22 Products
Required fields are marked with *
My Review for All CDH22 Products
Required fields are marked with *
0
Inquiry Basket