Recombinant Human CDH22 Protein, GST-tagged

• Cat.No.: CDH22-5180H
• Product Overview: Human CDH22 partial ORF ( NP_067071, 274 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the cadherin superfamily. The gene product is composed of five cadherin repeat domains and a cytoplasmic tail similar to the highly conserved cytoplasmic region of classical cadherins. Expressed predominantly in the brain, this putative calcium-dependent cell adhesion protein may play an important role in morphogenesis and tissue formation in neural and non-neural cells during development and maintenance of the brain and neuroendocrine organs. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.84 kDa
• AA Sequence: PPRFPQKMYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYHLKDESSSGGDVFKVTTDSDTQEAIIVVQKRLDFESQPVHTVILEALNKFVDPRFADLGTFRDQAIVRV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDH22 cadherin 22 [ Homo sapiens (human) ]
• Official Symbol: CDH22
• Synonyms: CDH22; cadherin 22; C20orf25; dJ998H6.1; cadherin-22; PB-cadherin; cadherin 22, type 2; cadherin-like 22; ortholog of rat PB-cadherin; pituitary and brain cadherin
• Gene ID: 64405
• mRNA Refseq: NM_021248
• Protein Refseq: NP_067071
• MIM: 609920
• UniProt ID: Q9UJ99