Recombinant Human CDH3 protein(681-780 aa), C-His-tagged

• Cat.No.: CDH3-2696H
• Product Overview: Recombinant Human CDH3 protein(P22223)(681-780 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 681-780 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: RKIKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHRGLEARPEVVLRNDVAPTIIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDTLLVF

Gene Information

• Gene Name: CDH3 cadherin 3, type 1, P-cadherin (placental) [ Homo sapiens ]
• Official Symbol: CDH3
• Synonyms: CDH3; cadherin 3, type 1, P-cadherin (placental); cadherin 3, P cadherin (placental); cadherin-3; CDHP; PCAD; calcium-dependent adhesion protein, placental; HJMD
• Gene ID: 1001
• mRNA Refseq: NM_001793
• Protein Refseq: NP_001784
• MIM: 114021
• UniProt ID: P22223