Recombinant Human CDH3 protein(681-780 aa), C-His-tagged
Cat.No. : | CDH3-2696H |
Product Overview : | Recombinant Human CDH3 protein(P22223)(681-780 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 681-780 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RKIKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHRGLEARPEVVLRNDVAPTIIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDTLLVF |
Gene Name | CDH3 cadherin 3, type 1, P-cadherin (placental) [ Homo sapiens ] |
Official Symbol | CDH3 |
Synonyms | CDH3; cadherin 3, type 1, P-cadherin (placental); cadherin 3, P cadherin (placental); cadherin-3; CDHP; PCAD; calcium-dependent adhesion protein, placental; HJMD; |
Gene ID | 1001 |
mRNA Refseq | NM_001793 |
Protein Refseq | NP_001784 |
MIM | 114021 |
UniProt ID | P22223 |
◆ Recombinant Proteins | ||
CDH3-2232P | Recombinant Pig CDH3 Protein (1-145 aa), His-tagged | +Inquiry |
Cdh3-5626M | Recombinant Mouse Cdh3 Protein (Glu100-Gly647), C-Fc tagged | +Inquiry |
CDH3-289H | Recombinant Human CDH3, MYC/DDK-tagged | +Inquiry |
CDH3-5376P | Recombinant Pig CDH3 protein, His-SUMOstar-tagged | +Inquiry |
CDH3-169H | Recombinant Human CDH3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH3-7636HCL | Recombinant Human CDH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH3 Products
Required fields are marked with *
My Review for All CDH3 Products
Required fields are marked with *
0
Inquiry Basket