Recombinant Human CDH4 Protein, GST-Tagged

Cat.No. : CDH4-0990H
Product Overview : Human CDH4 partial ORF (NP_001785, 635 a.a. - 734 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Based on studies in chicken and mouse, this cadherin is thought to play an important role during brain segmentation and neuronal outgrowth. In addition, a role in kidney and muscle development is indicated. Of particular interest are studies showing stable cis-heterodimers of cadherins 2 and 4 in cotransfected cell lines. Previously thought to interact in an exclusively homophilic manner, this is the first evidence of cadherin heterodimerization. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Molecular Mass : 36.74 kDa
AA Sequence : AADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDH4 cadherin 4, type 1, R-cadherin (retinal) [ Homo sapiens ]
Official Symbol CDH4
Synonyms CDH4; cadherin 4, type 1, R-cadherin (retinal); cadherin-4; R Cadherin; R-CAD; R-cadherin; retinal cadherin; cadherin 4, type 1, preproprotein; CAD4; RCAD; FLJ22202; FLJ40547; MGC126700; MGC138355;
Gene ID 1002
mRNA Refseq NM_001252338
Protein Refseq NP_001239267
MIM 603006
UniProt ID P55283

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDH4 Products

Required fields are marked with *

My Review for All CDH4 Products

Required fields are marked with *

0
cart-icon
0
compare icon