Recombinant Human CDH4 Protein, GST-Tagged
Cat.No. : | CDH4-0990H |
Product Overview : | Human CDH4 partial ORF (NP_001785, 635 a.a. - 734 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Based on studies in chicken and mouse, this cadherin is thought to play an important role during brain segmentation and neuronal outgrowth. In addition, a role in kidney and muscle development is indicated. Of particular interest are studies showing stable cis-heterodimers of cadherins 2 and 4 in cotransfected cell lines. Previously thought to interact in an exclusively homophilic manner, this is the first evidence of cadherin heterodimerization. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | AADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDH4 cadherin 4, type 1, R-cadherin (retinal) [ Homo sapiens ] |
Official Symbol | CDH4 |
Synonyms | CDH4; cadherin 4, type 1, R-cadherin (retinal); cadherin-4; R Cadherin; R-CAD; R-cadherin; retinal cadherin; cadherin 4, type 1, preproprotein; CAD4; RCAD; FLJ22202; FLJ40547; MGC126700; MGC138355; |
Gene ID | 1002 |
mRNA Refseq | NM_001252338 |
Protein Refseq | NP_001239267 |
MIM | 603006 |
UniProt ID | P55283 |
◆ Recombinant Proteins | ||
CDH4-1210C | Recombinant Chicken CDH4 | +Inquiry |
CDH4-601H | Recombinant Human CDH4 protein, His-tagged | +Inquiry |
CDH4-2788H | Recombinant Human CDH4 protein(761-840 aa), C-His-tagged | +Inquiry |
CDH4-8712Z | Recombinant Zebrafish CDH4 | +Inquiry |
CDH4-1397H | Recombinant Human CDH4 Protein (Leu667-Asp916), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH4-2723HCL | Recombinant Human CDH4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH4 Products
Required fields are marked with *
My Review for All CDH4 Products
Required fields are marked with *
0
Inquiry Basket