Recombinant Human CDH5 protein, GST-tagged

Cat.No. : CDH5-3677H
Product Overview : Recombinant Human CDH5 protein(54-241 aa), fused to GST tag, was expressed in E. coli.
Availability September 05, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 54-241 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGT
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CDH5 cadherin 5, type 2 (vascular endothelium) [ Homo sapiens ]
Official Symbol CDH5
Synonyms CDH5; cadherin 5, type 2 (vascular endothelium); cadherin 5, type 2, VE cadherin (vascular epithelium); cadherin-5; 7B4; CD144; VE cadherin; 7B4 antigen; VE-cadherin; cd144 antigen; endothelial-specific cadherin; vascular endothelial cadherin; cadherin 5, type 2, VE-cadherin (vascular epithelium); FLJ17376;
Gene ID 1003
mRNA Refseq NM_001795
Protein Refseq NP_001786
MIM 601120
UniProt ID P33151

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDH5 Products

Required fields are marked with *

My Review for All CDH5 Products

Required fields are marked with *

0
cart-icon
0
compare icon