Recombinant Human CDK1 protein, T7/His-tagged
Cat.No. : | CDK1-213H |
Product Overview : | Recombinant human CDK1 cDNA (297aa, Isoform-1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 297 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPST AIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSR RVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAEL ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDP AKRISGKMALNHPYFNDLDNQIKKM |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | CDK1 cyclin-dependent kinase 1 [ Homo sapiens ] |
Official Symbol | CDK1 |
Synonyms | CDK1; cyclin-dependent kinase 1; CDC2, cell division cycle 2, G1 to S and G2 to M; CDC28A; p34 protein kinase; cell cycle controller CDC2; cell division protein kinase 1; cell division control protein 2 homolog; cell division cycle 2, G1 to S and G2 to M; CDC2; P34CDC2; MGC111195; DKFZp686L20222; |
Gene ID | 983 |
mRNA Refseq | NM_001170406 |
Protein Refseq | NP_001163877 |
MIM | 116940 |
UniProt ID | P06493 |
Chromosome Location | 10q21.2 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Cyclin B, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; ARMS-mediated activation, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; |
Function | ATP binding; Hsp70 protein binding; RNA polymerase II carboxy-terminal domain kinase activity; cyclin binding; cyclin-dependent protein kinase activity; cyclin-dependent protein kinase activity; histone kinase activity; nucleotide binding; protein binding |
◆ Recombinant Proteins | ||
CDK1-3397HF | Active Recombinant Full Length Human CDK1 Protein, DDK-tagged, Biotinylated | +Inquiry |
CDK1-1533H | Recombinant Human CDK1, Unactive, GST-tagged | +Inquiry |
CDK1-2211M | Recombinant Mouse CDK1 protein, His&GST-tagged | +Inquiry |
CDK1-213H | Recombinant Human CDK1 protein, T7/His-tagged | +Inquiry |
CDK1-605R | Recombinant Rhesus Macaque CDK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK1-001MCL | Recombinant Mouse CDK1 cell lysate | +Inquiry |
CDK1-670HCL | Recombinant Human CDK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK1 Products
Required fields are marked with *
My Review for All CDK1 Products
Required fields are marked with *