Recombinant Human CDK11A, His-tagged
Cat.No. : | CDK11A-26652TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 350-636 of Human CDK11 / CDC2L2 with a N terminal His tag; predicted MWt 33 kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 350-636 a.a. |
Description : | This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L1, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L1, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions, which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L1 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Many transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only two have been determined so far. |
Conjugation : | HIS |
Tissue specificity : | Expressed ubiquitously. Some evidence of isoform-specific tissue distribution. |
Form : | Lyophilised:Reconstitution with 117 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEG DYVPDSPALLPIELKQELPKYLPALQGCRSVEEFQCLN RIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPI TSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVE HDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWI LHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTP VVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVF |
Sequence Similarities : | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.Contains 1 protein kinase domain. |
Gene Name | CDK11A cyclin-dependent kinase 11A [ Homo sapiens ] |
Official Symbol | CDK11A |
Synonyms | CDK11A; cyclin-dependent kinase 11A; CDC2L2, CDC2L3, cell division cycle 2 like 2 , cell division cycle 2 like 2 (PITSLRE proteins); CDK11 p46; CDK11 p58; CDK11 p110; p58GTA; PITSLRE; |
Gene ID | 728642 |
mRNA Refseq | NM_024011 |
Protein Refseq | NP_076916 |
MIM | 116951 |
Uniprot ID | Q9UQ88 |
Chromosome Location | 1p36.33 |
Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Mitotic G2-G2/M phases, organism-specific biosystem; Recruitment of mitotic centrosome proteins and complexes, organism-specific biosystem; |
Function | ATP binding; ATP binding; cyclin-dependent protein kinase activity; nucleotide binding; protein kinase activity; |
◆ Recombinant Proteins | ||
CDK11A-285H | Recombinant Human CDK11A protein, GST-tagged | +Inquiry |
CDK11A-722H | Recombinant Human CDK11A Protein, His-tagged | +Inquiry |
CDK11A-26652TH | Recombinant Human CDK11A, His-tagged | +Inquiry |
CDK11A-0922H | Recombinant Human CDK11A Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK11A Products
Required fields are marked with *
My Review for All CDK11A Products
Required fields are marked with *
0
Inquiry Basket