Recombinant Human CDK12 Protein, GST-tagged

• Cat.No.: CDK12-1888H
• Product Overview: Human CRK7 partial ORF ( NP_057591, 1281 a.a. - 1380 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CDK12 (Cyclin Dependent Kinase 12) is a Protein Coding gene. Among its related pathways are Gene Expression and DNA Damage. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDK13.
• Molecular Mass: 36.63 kDa
• AA Sequence: LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDK12 cyclin-dependent kinase 12 [ Homo sapiens ]
• Official Symbol: CDK12
• Synonyms: CDK12; cyclin-dependent kinase 12; Cdc2 related kinase, arginine/serine rich , CRKRS; CDC2 related protein kinase 7; CRK7; CRKR; KIAA0904; CDC2-related protein kinase 7; cell division protein kinase 12; Cdc2-related kinase, arginine/serine-rich; cell division cycle 2-related protein kinase 7; CRKRS; hCDK12
• Gene ID: 51755
• mRNA Refseq: NM_015083
• Protein Refseq: NP_055898
• MIM: 615514
• UniProt ID: Q9NYV4