Recombinant Human CDK12 Protein, GST-tagged
Cat.No. : | CDK12-1888H |
Product Overview : | Human CRK7 partial ORF ( NP_057591, 1281 a.a. - 1380 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CDK12 (Cyclin Dependent Kinase 12) is a Protein Coding gene. Among its related pathways are Gene Expression and DNA Damage. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDK13. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDK12 cyclin-dependent kinase 12 [ Homo sapiens ] |
Official Symbol | CDK12 |
Synonyms | CDK12; cyclin-dependent kinase 12; Cdc2 related kinase, arginine/serine rich , CRKRS; CDC2 related protein kinase 7; CRK7; CRKR; KIAA0904; CDC2-related protein kinase 7; cell division protein kinase 12; Cdc2-related kinase, arginine/serine-rich; cell division cycle 2-related protein kinase 7; CRKRS; hCDK12; |
Gene ID | 51755 |
mRNA Refseq | NM_015083 |
Protein Refseq | NP_055898 |
MIM | 615514 |
UniProt ID | Q9NYV4 |
◆ Recombinant Proteins | ||
CDK12-3192M | Recombinant Mouse CDK12 Protein | +Inquiry |
CDK12-07H | Recombinant Active Human CDK12/Cyclin K Complex Protein, GST-tagged | +Inquiry |
CDK12-16H | Recombinant Human CDK12 protein, GST-tagged | +Inquiry |
CDK12-1301R | Recombinant Rat CDK12 Protein | +Inquiry |
CDK12-1515M | Recombinant Mouse CDK12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK12 Products
Required fields are marked with *
My Review for All CDK12 Products
Required fields are marked with *
0
Inquiry Basket