Recombinant Human CDK12 Protein, GST-tagged

Cat.No. : CDK12-1888H
Product Overview : Human CRK7 partial ORF ( NP_057591, 1281 a.a. - 1380 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CDK12 (Cyclin Dependent Kinase 12) is a Protein Coding gene. Among its related pathways are Gene Expression and DNA Damage. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDK13.
Molecular Mass : 36.63 kDa
AA Sequence : LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDK12 cyclin-dependent kinase 12 [ Homo sapiens ]
Official Symbol CDK12
Synonyms CDK12; cyclin-dependent kinase 12; Cdc2 related kinase, arginine/serine rich , CRKRS; CDC2 related protein kinase 7; CRK7; CRKR; KIAA0904; CDC2-related protein kinase 7; cell division protein kinase 12; Cdc2-related kinase, arginine/serine-rich; cell division cycle 2-related protein kinase 7; CRKRS; hCDK12;
Gene ID 51755
mRNA Refseq NM_015083
Protein Refseq NP_055898
MIM 615514
UniProt ID Q9NYV4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK12 Products

Required fields are marked with *

My Review for All CDK12 Products

Required fields are marked with *

0
cart-icon