Recombinant Human CDK2AP1 protein, GST-tagged
| Cat.No. : | CDK2AP1-11047H |
| Product Overview : | Recombinant Human CDK2AP1 protein(1-115 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-115 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CDK2AP1 cyclin-dependent kinase 2 associated protein 1 [ Homo sapiens ] |
| Official Symbol | CDK2AP1 |
| Synonyms | CDK2AP1; cyclin-dependent kinase 2 associated protein 1; CDK2 associated protein 1; cyclin-dependent kinase 2-associated protein 1; doc 1; DOC1; DORC1; p12DOC 1; ST19; Deleted in oral cancer-1; deleted in oral cancer 1; CDK2-associated protein 1; putative oral cancer suppressor; doc-1; p12DOC-1; |
| Gene ID | 8099 |
| mRNA Refseq | NM_004642 |
| Protein Refseq | NP_004633 |
| MIM | 602198 |
| UniProt ID | O14519 |
| ◆ Recombinant Proteins | ||
| CDK2AP1-3179HF | Recombinant Full Length Human CDK2AP1 Protein, GST-tagged | +Inquiry |
| CDK2AP1-11047H | Recombinant Human CDK2AP1 protein, GST-tagged | +Inquiry |
| CDK2AP1-27910TH | Recombinant Human CDK2AP1, His-tagged | +Inquiry |
| CDK2AP1-5275H | Recombinant Human CDK2AP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CDK2AP1-3201M | Recombinant Mouse CDK2AP1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDK2AP1-7628HCL | Recombinant Human CDK2AP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK2AP1 Products
Required fields are marked with *
My Review for All CDK2AP1 Products
Required fields are marked with *
