Recombinant Human CDK2AP1 protein, GST-tagged

Cat.No. : CDK2AP1-11047H
Product Overview : Recombinant Human CDK2AP1 protein(1-115 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability June 16, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-115 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name CDK2AP1 cyclin-dependent kinase 2 associated protein 1 [ Homo sapiens ]
Official Symbol CDK2AP1
Synonyms CDK2AP1; cyclin-dependent kinase 2 associated protein 1; CDK2 associated protein 1; cyclin-dependent kinase 2-associated protein 1; doc 1; DOC1; DORC1; p12DOC 1; ST19; Deleted in oral cancer-1; deleted in oral cancer 1; CDK2-associated protein 1; putative oral cancer suppressor; doc-1; p12DOC-1;
Gene ID 8099
mRNA Refseq NM_004642
Protein Refseq NP_004633
MIM 602198
UniProt ID O14519

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK2AP1 Products

Required fields are marked with *

My Review for All CDK2AP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon