Recombinant Human CDK2AP2 protein, His-tagged

• Cat.No.: CDK2AP2-467H
• Product Overview: Recombinant Human CDK2AP2 protein(1-126 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-126 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CDK2AP2 cyclin-dependent kinase 2 associated protein 2 [ Homo sapiens ]
• Official Symbol: CDK2AP2
• Synonyms: CDK2AP2; cyclin-dependent kinase 2 associated protein 2; CDK2 associated protein 2; cyclin-dependent kinase 2-associated protein 2; DOC 1R; p14; tumor suppressor deleted in oral cancer related 1; DOC-1-related protein; CDK2-associated protein 2; tumor suppressor deleted in oral cancer-related 1; DOC-1R; FLJ10636
• Gene ID: 10263
• mRNA Refseq: NM_005851
• Protein Refseq: NP_005842
• UniProt ID: O75956