Recombinant Human CDK5RAP3, His-tagged
Cat.No. : | CDK5RAP3-62H |
Product Overview : | Recombinant Human CDK5 Regulatory Subunit-Associated Protein 3/CDK5RAP3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Lys506) of Human CDK5RAP3 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | CDK5 Regulatory Subunit-Associated Protein 3 (CDK5RAP3) is a member of the CDK5RAP3 family. CDK5RAP3 is widely expressed and it is phosphorylated by CDK5 in vitro. CDK5RAP3 regulates CDK5 activity via its interaction with CDK5R1. This interaction is prevented by the association between CDK5R1 and CDK5RAP3. CDK5RAP3 can also interact with enteric adenovirus serotype 41 fiber protein and UFL1. CDK5RAP3 may act as a potential regulator of CDK5 activity. In addition, CDK5RAP3 may be involved in cell proliferation. |
AA Sequence : | MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHY FHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLK KQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGA AAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPE QVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLE AGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAIL QGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMV QKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSLVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | CDK5RAP3 CDK5 regulatory subunit associated protein 3 [ Homo sapiens ] |
Official Symbol | CDK5RAP3 |
Synonyms | CDK5RAP3; CDK5 regulatory subunit associated protein 3; CDK5 regulatory subunit-associated protein 3; C53; FLJ13660; HSF 27; IC53; ischemic heart CDK5 activator binding protein C53; LXXLL/leucine zipper containing ARFbinding protein; LZAP; MST016; OK/SW cl.114; ischemic heart CDK5 activator-binding protein C53; LXXLL/leucine-zipper-containing ARFbinding protein; HSF-27; OK/SW-cl.114; |
Gene ID | 80279 |
mRNA Refseq | NM_176096 |
Protein Refseq | NP_788276 |
MIM | 608202 |
UniProt ID | Q96JB5 |
Chromosome Location | 17q21.2 |
Function | neuronal Cdc2-like kinase binding; protein binding; |
◆ Recombinant Proteins | ||
CDK5RAP3-1027H | Recombinant Human CDK5RAP3 Protein, GST-Tagged | +Inquiry |
CDK5RAP3-3128HF | Recombinant Full Length Human CDK5RAP3 Protein, GST-tagged | +Inquiry |
CDK5RAP3-3227C | Recombinant Chicken CDK5RAP3 | +Inquiry |
CDK5RAP3-4787H | Recombinant Human CDK5RAP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDK5RAP3-1308R | Recombinant Rat CDK5RAP3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK5RAP3-7623HCL | Recombinant Human CDK5RAP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK5RAP3 Products
Required fields are marked with *
My Review for All CDK5RAP3 Products
Required fields are marked with *