Recombinant Human CDK5RAP3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CDK5RAP3-4787H
Product Overview : CDK5RAP3 MS Standard C13 and N15-labeled recombinant protein (NP_788276) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms.
Molecular Mass : 56.9 kDa
AA Sequence : MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CDK5RAP3 CDK5 regulatory subunit associated protein 3 [ Homo sapiens (human) ]
Official Symbol CDK5RAP3
Synonyms CDK5RAP3; CDK5 regulatory subunit associated protein 3; CDK5 regulatory subunit-associated protein 3; C53; FLJ13660; HSF 27; IC53; ischemic heart CDK5 activator binding protein C53; LXXLL/leucine zipper containing ARFbinding protein; LZAP; MST016; OK/SW cl.114; ischemic heart CDK5 activator-binding protein C53; LXXLL/leucine-zipper-containing ARFbinding protein; HSF-27; OK/SW-cl.114;
Gene ID 80279
mRNA Refseq NM_176096
Protein Refseq NP_788276
MIM 608202
UniProt ID Q96JB5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK5RAP3 Products

Required fields are marked with *

My Review for All CDK5RAP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon