Recombinant Human CDK5RAP3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CDK5RAP3-4787H |
Product Overview : | CDK5RAP3 MS Standard C13 and N15-labeled recombinant protein (NP_788276) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms. |
Molecular Mass : | 56.9 kDa |
AA Sequence : | MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CDK5RAP3 CDK5 regulatory subunit associated protein 3 [ Homo sapiens (human) ] |
Official Symbol | CDK5RAP3 |
Synonyms | CDK5RAP3; CDK5 regulatory subunit associated protein 3; CDK5 regulatory subunit-associated protein 3; C53; FLJ13660; HSF 27; IC53; ischemic heart CDK5 activator binding protein C53; LXXLL/leucine zipper containing ARFbinding protein; LZAP; MST016; OK/SW cl.114; ischemic heart CDK5 activator-binding protein C53; LXXLL/leucine-zipper-containing ARFbinding protein; HSF-27; OK/SW-cl.114; |
Gene ID | 80279 |
mRNA Refseq | NM_176096 |
Protein Refseq | NP_788276 |
MIM | 608202 |
UniProt ID | Q96JB5 |
◆ Recombinant Proteins | ||
CDK5RAP3-787R | Recombinant Rhesus monkey CDK5RAP3 Protein, His-tagged | +Inquiry |
CDK5RAP3-613R | Recombinant Rhesus Macaque CDK5RAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK5RAP3-3128HF | Recombinant Full Length Human CDK5RAP3 Protein, GST-tagged | +Inquiry |
CDK5RAP3-1027H | Recombinant Human CDK5RAP3 Protein, GST-Tagged | +Inquiry |
CDK5RAP3-3227C | Recombinant Chicken CDK5RAP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK5RAP3-7623HCL | Recombinant Human CDK5RAP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK5RAP3 Products
Required fields are marked with *
My Review for All CDK5RAP3 Products
Required fields are marked with *